DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and daw1

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_989349.1 Gene:daw1 / 394975 XenbaseID:XB-GENE-5802528 Length:415 Species:Xenopus tropicalis


Alignment Length:456 Identity:95/456 - (20%)
Similarity:173/456 - (37%) Gaps:85/456 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DFDDGDDELQEIIELEEQPLDEDDDDLEEVTLEQLEARLAMAGGDDDEEEDEEELRDRERIAAIT 75
            :::.|.:...:.|:|.|.....|.|    :.:|:::....:......::..:..||.:|:|....
 Frog    18 EYEKGGELKTKAIDLLELSPTTDVD----LVVEEIQKAEPLITASRTQQVKQLILRLQEKIGQQD 78

  Fly    76 DEATVTFK---KHTAPVFACSLHPNYNWAVTGSEDDRAFVWETSTGDVLYEITEHKDTVTETHFS 137
            ......||   .|..|:...:.:.:.:..:|||.|....||:|::|:.|:.:..|::.|....|:
 Frog    79 SRQFYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFN 143

  Fly   138 HD-GVYLATGDLAGDLFVFKVSEKHDERPILTKIWEYSMSDMSWLF-WHRAAHILLA-------- 192
            :. |..:|||..             |:   ..|:|..........| .|.|..:.||        
 Frog   144 NPYGDKIATGSF-------------DK---TCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLI 192

  Fly   193 --GSDSGEVFVFRIPSG-ECKILPGQSSRCESGELSGDGKKLFTAYVNGSVKLWDLKSCQVLIDV 254
              ||......::.|.|| |...|.|.::...|...:..|.:|.|...:.:|.:|::.|       
 Frog   193 ATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPS------- 250

  Fly   255 NESHPMGFGEITHAVVACERESPFYVCAEASGECSSGKGIRYNTSFHNKTIRKMLFCTNNGPVST 319
                    |...|.::....|   ...|:.:.:||     ...|:..:|:.:  |:.:.||....
 Frog   251 --------GRRIHTLIGHRGE---ISSAQFNWDCS-----LIATASMDKSCK--LWDSLNGKCVA 297

  Fly   320 IQSEHGIECLAFAPSSADLKLFACGSLDGRISIWDYA-----------KSALRTICENPVPNDAV 373
            ..:.|..|.|.....|.. :|.|..|.||...::..:           :..:..||.|...|   
 Frog   298 TLTGHEDEVLDVTFDSTG-QLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGN--- 358

  Fly   374 IRIKWLNDHTILAATSQGNLNAFDARTGILKFTLTGHYYHIYEFVYKPQENLLLTVSEDNTAKIF 438
                     .||.|:|......::..||.....|.||...|:...:..:.|.::|.|:|||.:|:
 Frog   359 ---------RILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIITGSKDNTCRIW 414

  Fly   439 K 439
            :
 Frog   415 R 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 84/386 (22%)
WD40 <81..441 CDD:225201 84/386 (22%)
WD40 repeat 89..126 CDD:293791 9/36 (25%)
WD40 repeat 132..170 CDD:293791 6/38 (16%)
WD40 repeat 175..213 CDD:293791 11/49 (22%)
WD40 repeat 220..299 CDD:293791 13/78 (17%)
WD40 repeat 266..321 CDD:293791 10/54 (19%)
WD40 repeat 326..365 CDD:293791 9/49 (18%)
WD40 repeat 373..408 CDD:293791 6/34 (18%)
WD40 repeat 414..438 CDD:293791 7/23 (30%)
daw1NP_989349.1 CEP19 4..>81 CDD:317357 11/66 (17%)
WD40 84..373 CDD:238121 71/342 (21%)
WD 1 90..129 11/38 (29%)
WD40 repeat 96..132 CDD:293791 9/35 (26%)
WD 2 132..174 10/57 (18%)
WD40 repeat 137..175 CDD:293791 10/53 (19%)
WD 3 175..214 10/38 (26%)
WD40 repeat 181..217 CDD:293791 9/35 (26%)
WD 4 217..256 9/53 (17%)
WD40 repeat 222..258 CDD:293791 9/50 (18%)
WD 5 259..298 9/48 (19%)
WD40 repeat 265..300 CDD:293791 8/41 (20%)
WD 6 301..340 9/39 (23%)
WD40 repeat 306..342 CDD:293791 7/36 (19%)
WD 7 343..384 10/52 (19%)
WD40 repeat 348..384 CDD:293791 10/47 (21%)
WD40 376..414 CDD:197651 12/37 (32%)
WD 8 386..415 9/28 (32%)
WD40 repeat 390..414 CDD:293791 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.