| Sequence 1: | NP_001246760.1 | Gene: | CG5114 / 39624 | FlyBaseID: | FBgn0036460 | Length: | 445 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_988871.1 | Gene: | wdr61 / 394466 | XenbaseID: | XB-GENE-5751496 | Length: | 305 | Species: | Xenopus tropicalis |
| Alignment Length: | 239 | Identity: | 62/239 - (25%) |
|---|---|---|---|
| Similarity: | 95/239 - (39%) | Gaps: | 64/239 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 222 GELSGDGKKLFTAYVNGS----VKLWDLKSCQV-LIDVNESHPMGFGEITHAVVACERESPFYVC 281
Fly 282 AEAS-------GECSSGKGIRYNTSFHNKTIRKMLFCTNNGPVSTIQSEHGIECLAFAPSSADLK 339
Fly 340 LFACGSLDGRISIW-------DYAKSALRTICENPVPNDAVIRIKWLNDHTILAATS-QGNLNAF 396
Fly 397 DARTGILKFTLTGHYYHIYEFVYKPQENLLLTVSEDNTAKIFKV 440 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5114 | NP_001246760.1 | WD40 | 79..439 | CDD:295369 | 61/236 (26%) |
| WD40 | <81..441 | CDD:225201 | 62/239 (26%) | ||
| WD40 repeat | 89..126 | CDD:293791 | |||
| WD40 repeat | 132..170 | CDD:293791 | |||
| WD40 repeat | 175..213 | CDD:293791 | |||
| WD40 repeat | 220..299 | CDD:293791 | 23/88 (26%) | ||
| WD40 repeat | 266..321 | CDD:293791 | 12/61 (20%) | ||
| WD40 repeat | 326..365 | CDD:293791 | 11/45 (24%) | ||
| WD40 repeat | 373..408 | CDD:293791 | 12/35 (34%) | ||
| WD40 repeat | 414..438 | CDD:293791 | 8/23 (35%) | ||
| wdr61 | NP_988871.1 | WD 1 | 14..57 | 10/34 (29%) | |
| WD40 | 15..302 | CDD:238121 | 62/239 (26%) | ||
| WD40 repeat | 19..62 | CDD:293791 | 11/39 (28%) | ||
| WD 2 | 62..101 | 11/60 (18%) | |||
| WD40 repeat | 68..105 | CDD:293791 | 8/51 (16%) | ||
| WD 3 | 104..143 | 13/48 (27%) | |||
| WD40 repeat | 110..145 | CDD:293791 | 11/44 (25%) | ||
| WD 4 | 146..187 | 12/40 (30%) | |||
| WD40 repeat | 152..187 | CDD:293791 | 12/34 (35%) | ||
| WD 5 | 188..227 | 12/32 (38%) | |||
| WD40 repeat | 193..229 | CDD:293791 | 10/27 (37%) | ||
| WD 6 | 230..269 | ||||
| WD40 repeat | 235..272 | CDD:293791 | |||
| WD 7 | 272..305 | ||||
| WD40 repeat | 277..301 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG53955 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||