powered by:
Protein Alignment CG5114 and Spr
DIOPT Version :9
Sequence 1: | NP_001246760.1 |
Gene: | CG5114 / 39624 |
FlyBaseID: | FBgn0036460 |
Length: | 445 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_062054.1 |
Gene: | Spr / 29270 |
RGDID: | 3753 |
Length: | 262 |
Species: | Rattus norvegicus |
Alignment Length: | 36 |
Identity: | 12/36 - (33%) |
Similarity: | 17/36 - (47%) |
Gaps: | 1/36 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 370 ND-AVIRIKWLNDHTILAATSQGNLNAFDARTGILK 404
|| |.:...|..:.|.:...:.|.||||....|:.|
Rat 116 NDLAEVNNYWALNLTSMLCLTTGTLNAFSNSPGLSK 151
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100610 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.