DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and PRPF19

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_055317.1 Gene:PRPF19 / 27339 HGNCID:17896 Length:504 Species:Homo sapiens


Alignment Length:285 Identity:58/285 - (20%)
Similarity:105/285 - (36%) Gaps:51/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TDEATVTFKKHTAPVFACSLHPNYNWAVTGSEDDRAFVWETSTGDVLYEITEHKDTVTETHFSHD 139
            :::...|.|.||..|.:...||:.:...:.|.|....:|.......:..:..|:..||       
Human   253 SEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVT------- 310

  Fly   140 GVYL-ATGDLAGDLFVFKVSEKHDE---------RPILTKIW-EYSMSDMSWLFWHRAAHILLAG 193
            |:.| ||||       :.:|...|:         ..:|||:. |.|...::...:|....|...|
Human   311 GLSLHATGD-------YLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTG 368

  Fly   194 SDSGEVFVFRIPS-GECKILPGQSSRCESGELSGDGKKLFTAYVNGSVKLWDLKSCQ----VLID 253
            :...::.::.:.. ......||.|....|...|.:|..|.||..:.|||||||:..:    :.:|
Human   369 TMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLD 433

  Fly   254 VN-ESHPMGFGEITHAVVACERESPFYVCAEASGECSSGKGIRYNTSFHNKTIRKMLFCTNNGPV 317
            .| |...:.|.:....:.....:...|:|.:            :....|        |..::|..
Human   434 NNFEVKSLIFDQSGTYLALGGTDVQIYICKQ------------WTEILH--------FTEHSGLT 478

  Fly   318 STIQSEHGIECLAFAPSSADLKLFA 342
            :.:...|..:.:|.......||.::
Human   479 TGVAFGHHAKFIASTGMDRSLKFYS 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 58/281 (21%)
WD40 <81..441 CDD:225201 58/279 (21%)
WD40 repeat 89..126 CDD:293791 6/36 (17%)
WD40 repeat 132..170 CDD:293791 11/47 (23%)
WD40 repeat 175..213 CDD:293791 3/38 (8%)
WD40 repeat 220..299 CDD:293791 19/83 (23%)
WD40 repeat 266..321 CDD:293791 5/54 (9%)
WD40 repeat 326..365 CDD:293791 3/17 (18%)
WD40 repeat 373..408 CDD:293791
WD40 repeat 414..438 CDD:293791
PRPF19NP_055317.1 RING-Ubox_PRP19 4..56 CDD:319570
May mediate interaction with PSMC5. /evidence=ECO:0000250|UniProtKB:Q99KP6 68..223
Prp19 69..133 CDD:400774
WD 1 219..259 0/5 (0%)
WD40 223..503 CDD:238121 58/283 (20%)
WD40 repeat 224..262 CDD:293791 1/8 (13%)
WD 2 262..301 8/38 (21%)
WD40 repeat 268..304 CDD:293791 5/35 (14%)
WD 3 304..345 14/54 (26%)
WD40 repeat 309..344 CDD:293791 12/48 (25%)
WD 4 348..387 4/38 (11%)
WD40 repeat 354..389 CDD:293791 3/34 (9%)
WD 5 390..429 15/38 (39%)
WD40 repeat 395..431 CDD:293791 13/35 (37%)
WD 6 433..472 7/58 (12%)
WD40 repeat 438..464 CDD:293791 3/25 (12%)
WD 7 473..503 5/29 (17%)
WD40 repeat 476..502 CDD:293791 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.