DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and hif2

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_587735.1 Gene:hif2 / 2538701 PomBaseID:SPCC1235.09 Length:564 Species:Schizosaccharomyces pombe


Alignment Length:399 Identity:83/399 - (20%)
Similarity:140/399 - (35%) Gaps:149/399 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 EDEEELRDRERIAAITDEATVTFKKHTAPVFACSLHPNYNWAVTGSEDDRAFVWETSTGDVLYEI 124
            :|:.|.||.:  ..:.||:.|. |....|:...:..|     ||                   ||
pombe   146 KDKIEKRDID--ITMADESNVE-KDPARPIAVYNSSP-----VT-------------------EI 183

  Fly   125 TEHKDTVTETHFSHDGVYLATGDLAGDLFVFKVSEKH-----DERPILTK---IWEYS--MSDMS 179
            ||.|..          .:....|:..|.|.. :..||     |.||:|.:   ::|:|  |::.:
pombe   184 TEIKQV----------TFTGGEDIKSDFFKV-IPTKHPVTCADWRPLLQENYHVYEFSIGMTNAT 237

  Fly   180 WLFWHRAAHILLAGSDSGEVFVFRIPSGECKILPGQSSRCESGELSG-----DGKKLFTAYVNGS 239
                      |.:.|...|...|:..:..|.    ||| .::.:::|     .|..|..|:.:|.
pombe   238 ----------LASVSICEEQNDFKAKTDYCL----QSS-FDNQDITGVAWNNSGSFLAYAFFSGV 287

  Fly   240 VKLWDLKSCQVLIDVNESHPMGFGEITHAVVACERESPFYVCAEASGECSSGKGIRYNTSFHNKT 304
            ::::|....|:|                                               ||||  
pombe   288 IEIYDSHGSQIL-----------------------------------------------SFHN-- 303

  Fly   305 IRKMLFCTNNGPVSTIQSEHGIECLAFAPSSADLKLFACGSLDGRISIWDYAKS---ALRTICEN 366
                    |.|||           |:...|..|..| |.||.||.|:::|..|.   ::.|:.  
pombe   304 --------NKGPV-----------LSLKWSGTDTYL-AAGSADGTITLFDQLKQTQYSIDTLA-- 346

  Fly   367 PVPNDAVIRIKWLNDHTILAATSQGNLNAF--DARTGILKFTLTGHYYHIYEFVYKPQENLLLTV 429
                .:|:.|:|::....:.:..:|:|..:  |.:..:...: ..|...|....|..:.:||||.
pombe   347 ----SSVLDIEWISFDEFVTSDVEGSLRVYKVDGKAPVSTVS-HAHDNSIVALRYNLRISLLLTA 406

  Fly   430 SEDNTAKIF 438
            |.|.|.|::
pombe   407 SSDTTVKLW 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 77/380 (20%)
WD40 <81..441 CDD:225201 76/378 (20%)
WD40 repeat 89..126 CDD:293791 5/36 (14%)
WD40 repeat 132..170 CDD:293791 9/45 (20%)
WD40 repeat 175..213 CDD:293791 6/37 (16%)
WD40 repeat 220..299 CDD:293791 8/83 (10%)
WD40 repeat 266..321 CDD:293791 8/54 (15%)
WD40 repeat 326..365 CDD:293791 13/41 (32%)
WD40 repeat 373..408 CDD:293791 6/36 (17%)
WD40 repeat 414..438 CDD:293791 10/23 (43%)
hif2NP_587735.1 LisH 4..30 CDD:285685
WD40 <263..524 CDD:225201 46/229 (20%)
WD40 267..523 CDD:295369 46/225 (20%)
WD40 repeat 267..301 CDD:293791 8/80 (10%)
WD40 repeat 309..347 CDD:293791 13/44 (30%)
WD40 repeat 349..384 CDD:293791 6/34 (18%)
WD40 repeat 392..430 CDD:293791 9/24 (38%)
WD40 repeat 435..472 CDD:293791
WD40 repeat 478..515 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.