DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5114 and Spr

DIOPT Version :9

Sequence 1:	NP_001246760.1	Gene:	CG5114 / 39624	FlyBaseID:	FBgn0036460	Length:	445	Species:	Drosophila melanogaster
Sequence 2:	NP_035597.2	Gene:	Spr / 20751	MGIID:	103078	Length:	262	Species:	Mus musculus

Alignment Length:	60	Identity:	15/60 - (25%)
Similarity:	25/60 - (41%)	Gaps:	8/60 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   346 LDGRISIWDYAKSALRTICENPVPND-AVIRIKWLNDHTILAATSQGNLNAFDARTGILK 404
            ::...::.|.:|..|..       || |.:...|..:.|.:...:.|.||||....|:.|
Mouse    99 INNAATLGDVSKGFLNV-------NDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSK 151

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5114	NP_001246760.1	WD40	79..439	CDD:295369	15/60 (25%)
		WD40	<81..441	CDD:225201	15/60 (25%)
		WD40 repeat	89..126	CDD:293791
		WD40 repeat	132..170	CDD:293791
		WD40 repeat	175..213	CDD:293791
		WD40 repeat	220..299	CDD:293791
		WD40 repeat	266..321	CDD:293791
		WD40 repeat	326..365	CDD:293791	3/18 (17%)
		WD40 repeat	373..408	CDD:293791	9/32 (28%)
		WD40 repeat	414..438	CDD:293791
Spr	NP_035597.2	NADB_Rossmann	9..261	CDD:304358	15/60 (25%)
		adh_short	10..213	CDD:278532	15/60 (25%)
		Substrate binding	158..159
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	1	0.900	-	-		OOG6_100610
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900