DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and Spr

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_035597.2 Gene:Spr / 20751 MGIID:103078 Length:262 Species:Mus musculus


Alignment Length:60 Identity:15/60 - (25%)
Similarity:25/60 - (41%) Gaps:8/60 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 LDGRISIWDYAKSALRTICENPVPND-AVIRIKWLNDHTILAATSQGNLNAFDARTGILK 404
            ::...::.|.:|..|..       || |.:...|..:.|.:...:.|.||||....|:.|
Mouse    99 INNAATLGDVSKGFLNV-------NDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 15/60 (25%)
WD40 <81..441 CDD:225201 15/60 (25%)
WD40 repeat 89..126 CDD:293791
WD40 repeat 132..170 CDD:293791
WD40 repeat 175..213 CDD:293791
WD40 repeat 220..299 CDD:293791
WD40 repeat 266..321 CDD:293791
WD40 repeat 326..365 CDD:293791 3/18 (17%)
WD40 repeat 373..408 CDD:293791 9/32 (28%)
WD40 repeat 414..438 CDD:293791
SprNP_035597.2 NADB_Rossmann 9..261 CDD:304358 15/60 (25%)
adh_short 10..213 CDD:278532 15/60 (25%)
Substrate binding 158..159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100610
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.