DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and lis-1

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_499755.1 Gene:lis-1 / 176758 WormBaseID:WBGene00003047 Length:404 Species:Caenorhabditis elegans


Alignment Length:453 Identity:85/453 - (18%)
Similarity:151/453 - (33%) Gaps:156/453 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEEQPLDEDD-----DDLEE--VTLEQLEARLAMAGGDDDEEEDEEELRDRERIAAITDE----- 77
            |:|..|.|:|     ..||:  .|:.:|:.::     :|.|.:.:|..|:....|...|:     
 Worm    32 LKESSLSENDIKPLGGILEKKWTTVLRLQRKV-----NDLESKLQESQREINHGAPTRDKRQAAD 91

  Fly    78 ------ATVTFKKHTAPVFACSLHPNYNWAVTGSEDDRAFVWETSTGDVLYEITEHKDTVTETHF 136
                  .|.....|..|:.....||.:....:.|||....||:..||.:...:..|.|.|.:...
 Worm    92 WIPRPPETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHTDAVNDIAI 156

  Fly   137 SHDGVYLATGDLAGDLFVFKVSEKHDERPILTKIWEYSMSDMSWLFWHRAAHILLAGSDSGEVFV 201
                      |.||...|                  ...||:|...|           |.|:.: 
 Worm   157 ----------DAAGKQLV------------------SCSSDLSIKLW-----------DFGQTY- 181

  Fly   202 FRIPSGEC-KILPGQSSRCESGELSGDGKKLFTAYVNGSVKLWDLKSCQVLIDVNESHPMGFGEI 265
                  :| |.|.|......|......|..:.:|..:.::|.||:                    
 Worm   182 ------DCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDI-------------------- 220

  Fly   266 THAVVACERESPFYVCAEASGECSSGKGIRYNTSFHNKTIRKMLFCTNNGPVSTIQSEHGIECLA 330
                              ::|.|.      |....||..:| |:..:|:|               
 Worm   221 ------------------STGYCV------YTFRGHNDWVR-MIRISNDG--------------- 245

  Fly   331 FAPSSADLKLFACGSLDGRISIWDYAKSALRTICENPVPNDAVIRIKWLND-------------- 381
                    .|||..|||..:::|.:|..:.:.:..:  ...||..::|..|              
 Worm   246 --------TLFASASLDQTVTVWSFATKSAKLVLRD--HEHAVECVEWAPDTAYTNVTGQQPEGN 300

  Fly   382 --HTILAATSQGNLNAFDARTGILKFTLTGHYYHIYEFVYKPQENLLLTVSEDNTAKIFKVPA 442
              |.:.:.:...::.|::..||.:.|||..|...:....:.|:...|::|::|.|.:::::.|
 Worm   301 STHILFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSA 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 69/376 (18%)
WD40 <81..441 CDD:225201 68/376 (18%)
WD40 repeat 89..126 CDD:293791 9/36 (25%)
WD40 repeat 132..170 CDD:293791 4/37 (11%)
WD40 repeat 175..213 CDD:293791 8/38 (21%)
WD40 repeat 220..299 CDD:293791 9/78 (12%)
WD40 repeat 266..321 CDD:293791 9/54 (17%)
WD40 repeat 326..365 CDD:293791 8/38 (21%)
WD40 repeat 373..408 CDD:293791 9/50 (18%)
WD40 repeat 414..438 CDD:293791 5/23 (22%)
lis-1NP_499755.1 LisH 7..39 CDD:128913 3/6 (50%)
WD40 98..402 CDD:238121 70/382 (18%)
WD40 <100..404 CDD:225201 69/380 (18%)
WD40 repeat 109..146 CDD:293791 9/36 (25%)
WD40 repeat 152..189 CDD:293791 13/82 (16%)
WD40 repeat 194..230 CDD:293791 9/79 (11%)
WD40 repeat 237..272 CDD:293791 12/58 (21%)
WD40 repeat 278..329 CDD:293791 9/50 (18%)
WD40 repeat 335..371 CDD:293791 6/29 (21%)
WD40 repeat 377..401 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.