DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and AgaP_AGAP007739

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_317781.4 Gene:AgaP_AGAP007739 / 1278226 VectorBaseID:AGAP007739 Length:504 Species:Anopheles gambiae


Alignment Length:414 Identity:83/414 - (20%)
Similarity:138/414 - (33%) Gaps:130/414 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EELRDRERIAAITDEATVTFKKHTAPVFACSLHPNYNWAVTGSEDDRAFVWETSTGD------VL 121
            |.:...:.|.....:||| .:.|.:.||.|:.:|:.:...:||.|..|.:|:.|...      ||
Mosquito   137 ETMEVDQSIEIPASKATV-LRGHESEVFICAWNPSTDLLASGSGDSTARIWDMSDNPANPNQLVL 200

  Fly   122 --------YEITEHKDTVTETHFSHDGVYLATGDLAGDLFVFKVSEKHDERPILTKIWEYSMSDM 178
                    .|:..:|| ||...::.||..||||...|                ..:||       
Mosquito   201 RHCIQKGGTEVPSNKD-VTSLDWNCDGTLLATGSYDG----------------YARIW------- 241

  Fly   179 SWLFWHRAAHILLA--GSDSGEVFVFRIPSGECKILPGQSSRCESGELSGDGKKLFTAYVNGSVK 241
                  |...:|.:  |...|.:|..:                    .:..|..:.:|.|:.:..
Mosquito   242 ------RTDGLLASTLGQHKGPIFALK--------------------WNKRGNYILSAGVDKTTI 280

  Fly   242 LWDLKSCQV----------LIDVNESHPMGFGEITHAVVACERESPFYVCAEASGECSSGKGIRY 296
            :||..:.|.          .:||:......|       .:|..:...:||.         .|:  
Mosquito   281 IWDAATGQCTQQFSFHSAPALDVDWQSNQSF-------ASCSTDQCIHVCK---------LGV-- 327

  Fly   297 NTSFHNKTIRKMLFCTNNGPVSTIQSEHGIECLAFAPSSADLKLFACGSLDGRISIWDYAKSALR 361
                 :|.|:.....||.           :..:.:.|..   :|.|..|.|..:.||    |..:
Mosquito   328 -----DKPIKSFQGHTNE-----------VNAIKWDPQG---QLLASCSDDMTLKIW----SMKQ 369

  Fly   362 TICENPVP--NDAVIRIKWL---------NDHTILAATS-QGNLNAFDARTGILKFTLTGHYYHI 414
            ..|.:.:.  :..:..|||.         |.:.|||:.| ...:..:|...|:...|||.|...:
Mosquito   370 DTCVHDLQAHSKEIYTIKWSPTGTGTQNPNMNLILASASFDSTVRLWDVERGVCIHTLTKHTEPV 434

  Fly   415 YEFVYKPQENLLLTVSEDNTAKIF 438
            |...:.|....|.:.|.|....|:
Mosquito   435 YSVAFSPDGKFLASGSFDKCVHIW 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 80/398 (20%)
WD40 <81..441 CDD:225201 78/396 (20%)
WD40 repeat 89..126 CDD:293791 13/50 (26%)
WD40 repeat 132..170 CDD:293791 8/37 (22%)
WD40 repeat 175..213 CDD:293791 5/39 (13%)
WD40 repeat 220..299 CDD:293791 13/88 (15%)
WD40 repeat 266..321 CDD:293791 8/54 (15%)
WD40 repeat 326..365 CDD:293791 8/38 (21%)
WD40 repeat 373..408 CDD:293791 11/44 (25%)
WD40 repeat 414..438 CDD:293791 5/23 (22%)
AgaP_AGAP007739XP_317781.4 LisH 6..32 CDD:285685
WD40 154..459 CDD:238121 79/397 (20%)
WD40 repeat 162..206 CDD:293791 12/43 (28%)
WD40 repeat 218..253 CDD:293791 12/63 (19%)
WD40 repeat 258..294 CDD:293791 7/55 (13%)
eIF2A 261..469 CDD:285825 46/259 (18%)
WD40 repeat 301..335 CDD:293791 9/56 (16%)
WD40 repeat 341..377 CDD:293791 9/42 (21%)
WD40 repeat 383..428 CDD:293791 11/44 (25%)
WD40 repeat 434..458 CDD:293791 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.