DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5114 and KATNB1

DIOPT Version :9

Sequence 1:NP_001246760.1 Gene:CG5114 / 39624 FlyBaseID:FBgn0036460 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_005877.2 Gene:KATNB1 / 10300 HGNCID:6217 Length:655 Species:Homo sapiens


Alignment Length:434 Identity:86/434 - (19%)
Similarity:133/434 - (30%) Gaps:178/434 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ELQEIIELEEQPLDEDDDDLEEVTLEQLEARLAMAGGDDDEEEDEEELRDRERIAAIT-DEATVT 81
            :||||:        ....::..:.|.:...||...||||          .|..:.:|. ....::
Human    12 KLQEIV--------AHASNVSSLVLGKASGRLLATGGDD----------CRVNLWSINKPNCIMS 58

  Fly    82 FKKHTAPVFACSLHPNYNWAVTGSEDDRAFVWETSTGDVLYEITEHKDTVTETHFSHDGVYLATG 146
            ...||:||.:..|:......|.||:.....||:.....:|..:..||..:....|...|.::|:|
Human    59 LTGHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASG 123

  Fly   147 DLAGDLFVFKVSEKHDERPILTKIWEYSMSDMSWLFWHRAAHILLAGSDSGEVFVFRIPSGECKI 211
            ....::                |:|:...                    .|.||.:|..|     
Human   124 SQDTNI----------------KLWDIRR--------------------KGCVFRYRGHS----- 147

  Fly   212 LPGQSSRCESGELSGDGKKLFTAYVNGSVKLWDLKSCQVLIDVNESHPMGFGEITHAVVACERES 276
               |:.||.  ..|.|||.|.:|..:.:||||||                               
Human   148 ---QAVRCL--RFSPDGKWLASAADDHTVKLWDL------------------------------- 176

  Fly   277 PFYVCAEASGECSSGKGIRYNTSFHNKTIRKML--FCTNNGPVSTIQSEHGIECLAFAPSSADLK 339
                                       |..||:  |..:.|||:.::         |.|:.   .
Human   177 ---------------------------TAGKMMSEFPGHTGPVNVVE---------FHPNE---Y 202

  Fly   340 LFACGSLDGRISIWDYAK-----------SALRTICENP------------------VPNDA--V 373
            |.|.||.|..|..||..|           ..:|::..||                  .|...  |
Human   203 LLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQDSLRVYGWEPERCFDV 267

  Fly   374 IRIKW--------LNDHTILAATSQGNLNAFDARTGILKFTLTG 409
            :.:.|        .||..|..|.||.|::::  ...:.:.|.||
Human   268 VLVNWGKVADLAICNDQLIGVAFSQSNVSSY--VVDLTRVTRTG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5114NP_001246760.1 WD40 79..439 CDD:295369 73/372 (20%)
WD40 <81..441 CDD:225201 73/370 (20%)
WD40 repeat 89..126 CDD:293791 8/36 (22%)
WD40 repeat 132..170 CDD:293791 4/37 (11%)
WD40 repeat 175..213 CDD:293791 5/37 (14%)
WD40 repeat 220..299 CDD:293791 12/78 (15%)
WD40 repeat 266..321 CDD:293791 7/56 (13%)
WD40 repeat 326..365 CDD:293791 12/49 (24%)
WD40 repeat 373..408 CDD:293791 10/42 (24%)
WD40 repeat 414..438 CDD:293791
KATNB1NP_005877.2 Interaction with centrosomes 1..300 83/423 (20%)
Interaction with dynein. /evidence=ECO:0000250 1..284 77/405 (19%)
WD40 7..257 CDD:238121 73/378 (19%)
WD40 repeat 67..103 CDD:293791 7/35 (20%)
WD40 repeat 108..144 CDD:293791 9/71 (13%)
WD40 repeat 151..186 CDD:293791 17/94 (18%)
WD40 repeat 192..228 CDD:293791 12/47 (26%)
WD40 repeat 234..261 CDD:293791 3/26 (12%)
Interaction with PAFAH1B1. /evidence=ECO:0000250 285..434 8/27 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..422
DNA_pol3_gamma3 <386..>494 CDD:331207
Interaction with KATNA1 and NDEL1. /evidence=ECO:0000250 433..655
Katanin_con80 497..648 CDD:316447
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.