DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom and Ocho

DIOPT Version :9

Sequence 1:NP_524073.2 Gene:Tom / 39619 FlyBaseID:FBgn0026320 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001246759.1 Gene:Ocho / 39621 FlyBaseID:FBgn0040296 Length:149 Species:Drosophila melanogaster


Alignment Length:163 Identity:55/163 - (33%)
Similarity:79/163 - (48%) Gaps:19/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFITREYKFESSKVMEPKSDQHTMAMRSLRKLVKPLLRL---VKKKQLLRKTLAEIQNQNAVNA 62
            ||.|:::      |.:...........|.|:.|:||||..   :||:|..|.:....:.:   .|
  Fly     1 MSAISKQ------KTLNTMYKSKVSPSRRLKNLLKPLLGQFFNMKKEQPKRSSYIASEEK---EA 56

  Fly    63 SLEDMRKDPAASCDNMANEELEQRLYTDLRQCPTNVAMIV-QQGQQQSIVPVHPEQTFIPVHFAR 126
            ..|.:..|    .||||||.||.||..::|||....|:|| .:.....:..:..|..::||||||
  Fly    57 EFEWLSND----MDNMANEHLEHRLIEEIRQCAKEDAVIVYNENGSGELHTIDQEDYYVPVHFAR 117

  Fly   127 TTSGTFFWTSAEGARQHHEQQLRQQF-DRWVQA 158
            |.:|||||||.: .:......:...| |||.||
  Fly   118 TNAGTFFWTSVQ-PKACEPYAIEWNFLDRWAQA 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TomNP_524073.2 ESM4 1..158 CDD:292574 53/161 (33%)
OchoNP_001246759.1 ESM4 9..149 CDD:374249 49/147 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448322
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C16W
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12254
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.