DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17839 and myom1

DIOPT Version :10

Sequence 1:NP_996085.2 Gene:CG17839 / 39616 FlyBaseID:FBgn0036454 Length:1656 Species:Drosophila melanogaster
Sequence 2:XP_031759524.1 Gene:myom1 / 100101675 XenbaseID:XB-GENE-923326 Length:1555 Species:Xenopus tropicalis


Alignment Length:771 Identity:150/771 - (19%)
Similarity:236/771 - (30%) Gaps:271/771 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 GVLADPPSKLRTVAKTDSFVILDWNKPKRLADTVSTYHVKFRRLGVGDDYLTVEK----RQPPLI 580
            ||:..||:.|.....|.::|:|.|..|.:.......|:|:....|: |::..|..    :.|...
 Frog   538 GVIPGPPTDLTVTEATKNYVVLSWKPPGQRGHEGVMYYVEKCVAGI-DNWQRVNTEIPVKSPRFA 601

  Fly   581 LEGLESDIYYEFYVVSINAYGKSEASPRLITRTLPAEPVQQTAARYNMTTCCQASGLLP------ 639
            |..|.....|.|.|.|.|:.|..|          |:|..:.|.....:.....||.::|      
 Frog   602 LFDLAEGKSYSFRVRSCNSAGVGE----------PSEATEATVVGDKLDIPPPASNIIPTRNTDT 656

  Fly   640 ----------QCAPLCSYNIRLSDIERLGPACRAQMPILARCAAGGRDHSPCCSRRGVINACMPL 694
                      ....|..|.|..|                   .||.....||  ....:.....:
 Frog   657 SVVVTWTESKDARELVGYYIEAS-------------------IAGSGHWEPC--NNNPVKGKRFI 700

  Fly   695 CRGVMPLALTTKSSSASAAAAATSSSSGATAATSASATSNSNAAGAPSSSSSSASSGTSSNVPDC 759
            |.|::                     :|........|.   ||||....||.|.:....:.:...
 Frog   701 CHGLL---------------------TGQKYVFRVRAV---NAAGLSDYSSDSEAIEVKAAIGGG 741

  Fly   760 LSYAGNILQCFEEGTQNIPGPPEDVHATFVNQSSVSLAWTQPDVDNSNSSSSGNASPGDMITGDE 824
            |.:|             .|.||.|:......:.|:.|.|.:|                 .|||  
 Frog   742 LPHA-------------TPSPPYDITILESVRDSMVLGWKEP-----------------KITG-- 774

  Fly   825 LAAGAVDPANAGKDVP----NAGDATSGTTGTEDIEFIVQYGKVNNMTMYETVAKLENELTTNET 885
                       |.|:.    |..:...|..|        |:.:.|...:             :|.
 Frog   775 -----------GLDIKGYYVNFREVIDGVAG--------QWHEANIKAI-------------SER 807

  Fly   886 SIDLTNLDANALYRITVVTRGKFGTSLPASMLLLNTTDQQRTGEAW--GAPSPPHSLTVVAHSAT 948
            :..:.||..|.:|:..|:.....|...|:.      ..:....|.|  ..|.|||.||:....:|
 Frog   808 AYRILNLKENTVYQYEVMACNLAGVGTPSQ------PSKPFKCEEWTIAVPGPPHQLTLREVRST 866

  Fly   949 WMQLTWQPPEYA--HP--------------HERITYRVYHKAMRAEQFIKIETKLAWLRMNNLKP 997
            .|.|.||||.|.  :|              .||  :|..::...|.::|||.         :|:.
 Frog   867 SMVLLWQPPVYTGRNPVTGYYIDIKEADAGDER--WRGVNEKQTANKYIKIV---------DLQE 920

  Fly   998 SSQHVLYVEAVGERGDSLPSETLVAWTDPALPAFVDPPTVHPADNIPEGGSMTILCLAF------ 1056
            .:::||.|.||.:.|....|:.    |||.| |...|.|......:.:.|   |:.|.|      
 Frog   921 GARYVLRVRAVNQAGVGKSSDL----TDPVL-AQTKPGTKEVEVIVDDDG---IISLNFECDQLT 977

  Fly  1057 --------------GNPAPTISLYVGGHLVR---QDASRH-------MVTVIHNVSA----DMEH 1093
                          .:.:..:|:...|...:   :|.|..       :||....||:    |.|.
 Frog   978 PDSKFIWSKNYEPIDDDSSRVSVETKGGRTKVSFKDPSEEDLGIYSCVVTETDGVSSSYTLDAEE 1042

  Fly  1094 ----VSCYADNGYGV-PMQATRRVNICYPPKIQAAGITVANIGDEIELRCTVDSKPAPKTIFWRE 1153
                :....||.|.| |:::...|.|....:::                            ||.:
 Frog  1043 LKRLLQLSHDNKYPVIPLKSELAVEILEKGQVR----------------------------FWMQ 1079

  Fly  1154 KDGRVP------------VINGGNYFISVKANESRPSIYTMSLRISKLQANDVGDY 1197
            .:...|            :.:|..|.:|:..|..     ...:.:.||:..|.|.|
 Frog  1080 AEKLSPNAKVNHVFNDKEIKDGDKYNMSMDRNTG-----IAQMVMEKLEDEDEGTY 1130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17839NP_996085.2 Ig 33..116 CDD:472250
DB 185..278 CDD:460293
FN3 286..396 CDD:238020
DB 424..515 CDD:460293
FN3 524..613 CDD:238020 23/92 (25%)
DB 631..>705 CDD:460293 13/89 (15%)
FN3 773..>1036 CDD:442628 64/284 (23%)
FN3 934..1024 CDD:238020 30/105 (29%)
Ig 1029..1103 CDD:472250 19/111 (17%)
Ig strand B 1049..1053 CDD:409562 1/3 (33%)
Ig strand C 1062..1066 CDD:409562 1/3 (33%)
Ig strand E 1080..1083 CDD:409562 1/2 (50%)
Ig strand F 1093..1098 CDD:409562 0/8 (0%)
IG_like 1126..1216 CDD:214653 12/84 (14%)
Ig strand B 1134..1138 CDD:409390 0/3 (0%)
Ig strand C 1148..1152 CDD:409390 1/3 (33%)
Ig strand E 1182..1186 CDD:409390 0/3 (0%)
Ig strand F 1196..1201 CDD:409390 1/2 (50%)
Ig strand G 1209..1212 CDD:409390
DB 1229..1315 CDD:460293
FN3 1323..1457 CDD:238020
myom1XP_031759524.1 IgI_titin_I1-like 182..275 CDD:409543
Ig strand A 182..184 CDD:409543
Ig strand A' 186..192 CDD:409543
Ig strand B 199..206 CDD:409543
Ig strand C 212..217 CDD:409543
Ig strand C' 219..222 CDD:409543
Ig strand D 230..234 CDD:409543
Ig strand E 239..246 CDD:409543
Ig strand F 253..261 CDD:409543
Ig strand G 264..275 CDD:409543
Ig 320..388 CDD:472250
Ig strand C 343..347 CDD:409353
Ig strand E 368..372 CDD:409353
Ig strand F 382..387 CDD:409353
FN3 413..503 CDD:238020
FN3 <474..>784 CDD:442628 65/344 (19%)
FN3 747..839 CDD:238020 26/148 (18%)
FN3 852..941 CDD:238020 29/99 (29%)
Ig 955..1027 CDD:472250 8/74 (11%)
Ig strand B 969..973 CDD:409405 2/3 (67%)
Ig strand C 981..985 CDD:409405 0/3 (0%)
Ig strand E 1007..1011 CDD:409405 0/3 (0%)
Ig strand F 1021..1026 CDD:409405 0/4 (0%)
Ig <1193..1257 CDD:472250
Ig strand C 1202..1206 CDD:409521
Ig strand E 1225..1229 CDD:409521
Ig strand F 1239..1244 CDD:409521
Ig strand G 1252..1255 CDD:409521
Ig 1386..1477 CDD:472250
Ig strand B 1404..1408 CDD:409353
Ig strand C 1417..1421 CDD:409353
Ig strand E 1443..1447 CDD:409353
Ig strand F 1457..1462 CDD:409353
Ig strand G 1470..1473 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.