DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bmm and AT1G33270

DIOPT Version :9

Sequence 1:NP_001163445.1 Gene:bmm / 39611 FlyBaseID:FBgn0036449 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_174597.2 Gene:AT1G33270 / 840222 AraportID:AT1G33270 Length:369 Species:Arabidopsis thaliana


Alignment Length:265 Identity:72/265 - (27%)
Similarity:117/265 - (44%) Gaps:61/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SFAGCGFLGIYHVGVAVCFKKYAPHLLLEK--------IGGASAGSLAACCLLCDLPLGSMTSDF 60
            ||:..|.|..||:|||        .||:||        :.|:|||:: .|.::..   |:...:.
plant   121 SFSAAGLLFPYHLGVA--------QLLIEKGYIKETTPLAGSSAGAI-VCAVITS---GATMREA 173

  Fly    61 FRVVNEARRYSLGPFSPSFNIQTCLLEGLQKHLPDDAHKRVNGRLHISLTRVY-DGKNVIISEFE 124
            .....|. .|.......:|.:...|.|.:::.||||.|.|.|||:.:::|:|: ..:.:::.:|:
plant   174 LEATKEL-AYDCRRNGTAFRLGAVLRESMERLLPDDIHIRSNGRIRVAITQVFWRPRGLLVDQFD 237

  Fly   125 SREEVLQALLCACFIPGFSGILPPR----FRGVRYMDGAFSDNL-PILDENTITVSPFCGES--- 181
            |:.:::.|:..:.||||:   |.||    ||....:||..:..: |.....|:.|..|...:   
plant   238 SKSDLIDAVFTSSFIPGY---LAPRPATMFRNRLCVDGGLTLFMPPTAAAKTVRVCAFSASNFKL 299

  Fly   182 ---DICP------RDQSSQLFHLNWANTSIEISRQNINRFVRILFPPRPEFLSKFCQQGFDDALQ 237
               :|||      |..|.||  ||||                 |.|...|.|.:..:.|:.||..
plant   300 KGIEICPDCNPLNRATSRQL--LNWA-----------------LEPAEDEVLERLFELGYADAAT 345

  Fly   238 FLHRN 242
            :...|
plant   346 WAEMN 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bmmNP_001163445.1 Pat_iPLA2 1..245 CDD:132857 72/265 (27%)
AT1G33270NP_174597.2 Pat_like 119..349 CDD:132863 71/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3546
eggNOG 1 0.900 - - E1_KOG3773
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I2461
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204225at2759
OrthoFinder 1 1.000 - - FOG0000670
OrthoInspector 1 1.000 - - otm3362
orthoMCL 1 0.900 - - OOG6_103947
Panther 1 1.100 - - O PTHR12406
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1585
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.