DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bmm and Pnpla5

DIOPT Version :9

Sequence 1:NP_001163445.1 Gene:bmm / 39611 FlyBaseID:FBgn0036449 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001123969.1 Gene:Pnpla5 / 300108 RGDID:1307495 Length:453 Species:Rattus norvegicus


Alignment Length:246 Identity:106/246 - (43%)
Similarity:155/246 - (63%) Gaps:3/246 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NLSFAGCGFLGIYHVGVAVCFKKYAPHLL--LEKIGGASAGSLAACCLLCDLPLGSMTSDFFRVV 64
            :|||:|.|:||:||||...|.::.||.|:  ..:..|:|:|:|.|..::|........|:...:|
  Rat    31 SLSFSGSGYLGLYHVGATECLRQRAPRLIQGARRFYGSSSGALNALSIICGKSADFTCSNLLAMV 95

  Fly    65 NEARRYSLGPFSPSFNIQTCLLEGLQKHLPDDAHKRVNGRLHISLTRVYDGKNVIISEFESREEV 129
            ....|.|||.|.|::.....:.:.||..|||::|...:.||.|||||..||:|.|:::|.:|:|:
  Rat    96 KHVERLSLGIFHPAYGPIEHIKKKLQDDLPDNSHIVASQRLGISLTRWPDGQNFIVTDFATRDEL 160

  Fly   130 LQALLCACFIPGFSGILPPRFRGVRYMDGAFSDNLPILD-ENTITVSPFCGESDICPRDQSSQLF 193
            :|||:|..:.|.:.|.:||.|||.|::|||.|:|||..: ..|||||||.|..||||:..||.||
  Rat   161 IQALVCTLYFPFYCGTIPPAFRGERFIDGALSNNLPFSNCPTTITVSPFNGTVDICPQSTSSSLF 225

  Fly   194 HLNWANTSIEISRQNINRFVRILFPPRPEFLSKFCQQGFDDALQFLHRNNL 244
            .|...|.|.:||.:|.....:.||||:||.::.:|:||:.|||:||.|..|
  Rat   226 ELTAFNASFQISTRNFFLGFKSLFPPKPEVVADYCRQGYLDALRFLERRGL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bmmNP_001163445.1 Pat_iPLA2 1..245 CDD:132857 106/246 (43%)
Pnpla5NP_001123969.1 Pat_PNPLA5-mammals 21..423 CDD:132862 106/246 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3773
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204225at2759
OrthoFinder 1 1.000 - - FOG0000670
OrthoInspector 1 1.000 - - mtm8965
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12406
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.