DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bmm and B0524.2

DIOPT Version :9

Sequence 1:NP_001163445.1 Gene:bmm / 39611 FlyBaseID:FBgn0036449 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_497474.3 Gene:B0524.2 / 182024 WormBaseID:WBGene00015241 Length:348 Species:Caenorhabditis elegans


Alignment Length:247 Identity:85/247 - (34%)
Similarity:135/247 - (54%) Gaps:12/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSFAGCGFLGIYHVGVAVCFKKYAPHLL--LEKIGGASAGSLAACCLLCDLP--LGSMTSDFFRV 63
            |||.||||||.|..|.|.....:...|:  :|:..|.|:|||.|...:.: |  :.....:.:::
 Worm    97 LSFGGCGFLGSYQFGAAKMIFDHGKKLMKRVERYSGCSSGSLVAAMFIFN-PEKISEAVEEIYKM 160

  Fly    64 VNEARRYSLGPFSPSFNIQTCLLEGLQKHLPDDAHKRVNGRLHISLTRVYDGKNVIISEFESREE 128
            .:|....:||..||.|.|...|.:.::|.||||..| .|..|.:|:|::...||.:||.|||:.:
 Worm   161 ADEVNDKTLGAMSPGFVISDRLRKVVEKFLPDDVAK-ANDLLFVSVTKLKTWKNELISNFESKID 224

  Fly   129 VLQALLCACFIPGFSGIL---PPRFRGVRYMDGAFSDNLP-ILDENTITVSPFCGESDICPRDQS 189
            ::..|:.:|:.|.:|..|   .|..||..|:||.:|:.:| .||..|:|||.|.|::||||.::|
 Worm   225 LIDCLMASCYHPMYSSGLNGKAPILRGEAYIDGGYSNMIPEFLDMRTVTVSAFAGDADICPVEKS 289

  Fly   190 SQL--FHLNWANTSIEISRQNINRFVRILFPPRPEFLSKFCQQGFDDALQFL 239
            :..  |...:.|.:::::..|:.|....||||....|.::...|..||.:.|
 Worm   290 ALFNDFMFAFFNQNMKLTLSNMKRVTNALFPPTRAILQEYFNAGARDAEKLL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bmmNP_001163445.1 Pat_iPLA2 1..245 CDD:132857 85/247 (34%)
B0524.2NP_497474.3 Pat_PNPLA4 96..345 CDD:132861 85/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204225at2759
OrthoFinder 1 1.000 - - FOG0000670
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4990
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.