DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bmm and pnpla1

DIOPT Version :9

Sequence 1:NP_001163445.1 Gene:bmm / 39611 FlyBaseID:FBgn0036449 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_021325557.1 Gene:pnpla1 / 101885488 ZFINID:ZDB-GENE-140912-3 Length:406 Species:Danio rerio


Alignment Length:171 Identity:70/171 - (40%)
Similarity:104/171 - (60%) Gaps:1/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SPSFNIQTCLLEGLQKHLPDDAHKRVNGRLHISLTRVYDGKNVIISEFESREEVLQALLCACFIP 140
            ||:.||...|...||:.|||:||....||||:|:||:.||.|||.|:|.|::::::||||:||||
Zfish     2 SPTVNIYGWLEMTLQRCLPDNAHTLATGRLHVSMTRMADGTNVIASQFHSKDDLIKALLCSCFIP 66

  Fly   141 GFSGILPPRFRGVRYMDGAFSDNLPILDE-NTITVSPFCGESDICPRDQSSQLFHLNWANTSIEI 204
            ..:|::||:::|..:|||.|::..|:.|. ..:|:|||.|..||||.|.|:.|........:.:.
Zfish    67 VLAGVIPPQYKGEHFMDGGFTNIQPLEDSFPALTISPFAGNMDICPSDSSTSLCDAIIQQLAFQC 131

  Fly   205 SRQNINRFVRILFPPRPEFLSKFCQQGFDDALQFLHRNNLI 245
            |..|..|.|..:|......|.|....|:.|.:.||.:||.:
Zfish   132 SLTNFIRLVDAIFARDWRVLKKAFYSGYQDTVFFLQQNNAL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bmmNP_001163445.1 Pat_iPLA2 1..245 CDD:132857 70/169 (41%)
pnpla1XP_021325557.1 Patatin_and_cPLA2 <2..172 CDD:325016 70/169 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.