DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bmm and pnpla1

DIOPT Version :9

Sequence 1:NP_001163445.1 Gene:bmm / 39611 FlyBaseID:FBgn0036449 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_017946987.1 Gene:pnpla1 / 100497390 XenbaseID:XB-GENE-6464189 Length:276 Species:Xenopus tropicalis


Alignment Length:262 Identity:107/262 - (40%)
Similarity:156/262 - (59%) Gaps:15/262 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NLSFAGCGFLGIYHVGVAVCFKKYAPHLL--LEKIGGASAGSLAACCLLCDLPLGSMTSDFFRVV 64
            :|||:|.|||.:|.:|........||.||  ..|:.|||.||:.|..::..|.:..:........
 Frog    13 SLSFSGSGFLSVYQMGAVNALWDLAPELLHSAPKVYGASGGSIVAAAVVLRLNIDQVEKTIVEAA 77

  Fly    65 NEARRYSLGPFSPSFNIQTCLLEGLQKHLPDDAHKRVNGRLHISLTRVYDGKNVIISEFESREEV 129
            .:|.:..|||....||:.|.|...||..|||:||:...|||::.:||:.||||::||:::|:|||
 Frog    78 KDASKSVLGPLLSKFNLVTILQNALQHILPDNAHEEATGRLYVGVTRLSDGKNIMISDYKSKEEV 142

  Fly   130 LQALLCACFIPGFSGILPPRFRGVRYMDGAFSDNLPILDENT-ITVSPFCGESDICPRDQSSQLF 193
            :|||:|:||:|.:.|::||.||||||:||..|...|...:.: ||||||.||.||||||  |.|.
 Frog   143 IQALICSCFVPIYCGLVPPSFRGVRYIDGGLSGFQPRYGKTSMITVSPFSGEIDICPRD--SPLC 205

  Fly   194 H--LNWANTSIEISRQNINRFVRILFPPRPEFLSKFCQQGFDDALQFLHR--------NNLINCR 248
            |  |:..|||.:::..|::|....||||....|::|..||:.||..:|.|        ..::..:
 Frog   206 HLCLHVCNTSFQLTAGNLSRISYALFPPPIWMLNEFFYQGYKDAADYLQRVGINKAQEQTILGTQ 270

  Fly   249 RC 250
            :|
 Frog   271 QC 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bmmNP_001163445.1 Pat_iPLA2 1..245 CDD:132857 106/255 (42%)
pnpla1XP_017946987.1 Patatin_and_cPLA2 11..>256 CDD:416256 105/244 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204225at2759
OrthoFinder 1 1.000 - - FOG0000670
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12406
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.