DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bmm and pnpla4

DIOPT Version :9

Sequence 1:NP_001163445.1 Gene:bmm / 39611 FlyBaseID:FBgn0036449 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_002939012.2 Gene:pnpla4 / 100495026 XenbaseID:XB-GENE-968680 Length:271 Species:Xenopus tropicalis


Alignment Length:243 Identity:93/243 - (38%)
Similarity:143/243 - (58%) Gaps:4/243 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNLSFAGCGFLGIYHVGVAVCFKKYAPHLL--LEKIGGASAGSLAACCLLCDLPLGSMTSDFFRV 63
            :||||:..|||||||:|.|....|:...:|  ::...|||||||.|..||........:.:|...
 Frog    20 LNLSFSASGFLGIYHLGAASALLKHGQKMLKYVKCFAGASAGSLVATVLLTAPDKIKESKEFLYA 84

  Fly    64 VNE-ARRYSLGPFSPSFNIQTCLLEGLQKHLPDDAHKRVNGRLHISLTRVYDGKNVIISEFESRE 127
            .:| .|:..||..:|:::....|..|::..||.:||:....||::|:|.....||.::|.|.|||
 Frog    85 FSEDVRKQKLGAMTPAYDFMKNLRGGIESILPVNAHEMAEHRLYVSITNAKSRKNCLVSHFASRE 149

  Fly   128 EVLQALLCACFIPGFSGILPPRFRGVRYMDGAFSDNLPIL-DENTITVSPFCGESDICPRDQSSQ 191
            |:::.||.:.::|.::||....::|.::.||.|:|:||.| :..|||||||.|..||||:|:...
 Frog   150 ELIKVLLASSYVPLYAGIKAVDYKGEKWFDGGFTDSLPHLPNGRTITVSPFSGRLDICPQDKPLW 214

  Fly   192 LFHLNWANTSIEISRQNINRFVRILFPPRPEFLSKFCQQGFDDALQFL 239
            ..::.:|..||.:|..|:.|..:.|||||.|.:....|.|:.||:.||
 Frog   215 DLYVTFAKHSILLSEANLRRLNQALFPPRQEKMEAIFQDGYKDAVNFL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bmmNP_001163445.1 Pat_iPLA2 1..245 CDD:132857 93/243 (38%)
pnpla4XP_002939012.2 Pat_PNPLA4 21..266 CDD:132861 93/242 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204225at2759
OrthoFinder 1 1.000 - - FOG0000670
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.