DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mop and PTPN5

DIOPT Version :9

Sequence 1:NP_648722.2 Gene:mop / 39610 FlyBaseID:FBgn0036448 Length:1833 Species:Drosophila melanogaster
Sequence 2:XP_016873923.1 Gene:PTPN5 / 84867 HGNCID:9657 Length:719 Species:Homo sapiens


Alignment Length:597 Identity:125/597 - (20%)
Similarity:203/597 - (34%) Gaps:184/597 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1229 SYQFSQSGKQQSVGTTDSEIASR----SNTATGFDSPIVSHTKVNMAAKDSTSAIEGNESSNYYS 1289
            :|:.::| ::::....|||..:.    |....|...|||      |.|.|....::.::      
Human     2 NYEGARS-ERENHAADDSEGGALDMCCSERLPGLPQPIV------MEALDEAEGLQDSQ------ 53

  Fly  1290 TPYGYLGSVNPQQQPTPAPPS--NSTASIYMQSGASSTAETQTTS------------------SG 1334
                       ::.|.|.|||  :..|......||.|.:.|..:|                  ||
Human    54 -----------REMPPPPPPSPPSDPAQKPPPRGAGSHSLTVRSSLCLFAASQFLLACGVLWFSG 107

  Fly  1335 VPYASSAALTKVEPKPEALPPKVTSNVDLLSDLD----IDCSVAVPPPML--------------- 1380
            ..:..|...|.:          |:|.:.||..|:    :|......|.:|               
Human   108 YGHIWSQNATNL----------VSSLLTLLKQLEPTAWLDSGTWGVPSLLLVFLSVGLVLVTTLV 162

  Fly  1381 -------PQPVLQPQVVATPTPPASQVSVPVKVESVAEHAAPATAEIPVAATEGTAQTPVTIPSG 1438
                   |:|       .||.||..      :.:||:...:...:|......|........:|..
Human   163 WHLLRTPPEP-------PTPLPPED------RRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPET 214

  Fly  1439 PKCASLDNLSNCSDLSS-------LENFDWDSVSVTHSVSEKQTKASATANGHSSSFAFQSETFT 1496
            |....:.::...:|.:|       |:.....:||:|..:        .|...:...|.:.... .
Human   215 PVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDM--------CTPGCNEEGFGYLMSP-R 270

  Fly  1497 DEKTTKYFQKEVESYEKLL--ENLHVKMLNGKTQLGAKWQELQQKLDKEAAANKRSTTIAKLFPE 1559
            :|...:|    :.|..::|  |.||.|.|: ...|.|::.|:....     .:.:...|..|. .
Human   271 EESAREY----LLSASRVLQAEELHEKALD-PFLLQAEFFEIPMNF-----VDPKEYDIPGLV-R 324

  Fly  1560 KNRSLDCLPYDHARVKL-----DKQTDDYINAAYMKNLSAGCPNFIVAQTPQPNTINDFWSMIWS 1619
            |||....||..|:||.|     |.....||||.|::........:|..|.|..:|:.|||.|:|.
Human   325 KNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQ 389

  Fly  1620 EKSRTVVCLHTP-----------NELFDPYWPQALDQPTHYDDYTVTCLKVQQLSHCSEYQLKLS 1673
            |        |||           ||....|||   ::...||...:|   ||::.|..:|:|:|.
Human   390 E--------HTPIIVMITNIEEMNEKCTEYWP---EEQVAYDGVEIT---VQKVIHTEDYRLRLI 440

  Fly  1674 MHGADAVLDLSLLQLKQWTKGAPAQLLGVAENALETHRQRCKAANA------PQSPLIMNCLTGS 1732
            .           |:.:.|           .:..|..|:....||.|      |:..:......|.
Human   441 S-----------LKCRDW-----------EDRLLHCHQHLLPAAAAGGCGGHPEDHVPAPSGQGR 483

  Fly  1733 ERSELVAIGVCA 1744
            ...::.|:.|||
Human   484 HDPDMRAVPVCA 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mopNP_648722.2 BRO1_HD-PTP_like 2..363 CDD:185762
V_HD-PTP_like 368..702 CDD:185747
ALIX_LYPXL_bnd 421..699 CDD:290660
Med15 808..>1246 CDD:255446 2/16 (13%)
Y_phosphatase 1558..1788 CDD:278528 55/209 (26%)
PTPc 1559..1745 CDD:238006 55/208 (26%)
PTPN5XP_016873923.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.