DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mop and PTPN2

DIOPT Version :9

Sequence 1:NP_648722.2 Gene:mop / 39610 FlyBaseID:FBgn0036448 Length:1833 Species:Drosophila melanogaster
Sequence 2:XP_005258181.1 Gene:PTPN2 / 5771 HGNCID:9650 Length:438 Species:Homo sapiens


Alignment Length:272 Identity:73/272 - (26%)
Similarity:123/272 - (45%) Gaps:61/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1532 KWQELQQKLDKEAAANKRSTTIAKLFPE---KNRSLDCLPYDHARVKLDKQTDDYINAAYMKNLS 1593
            :||.|..::..|  ::.....:|| |||   :||..|..||||:||||....:|||||: :.::.
Human    17 RWQPLYLEIRNE--SHDYPHRVAK-FPENRNRNRYRDVSPYDHSRVKLQNAENDYINAS-LVDIE 77

  Fly  1594 AGCPNFIVAQTPQPNTINDFWSMIWSEKSRTVVCLHTPNELFD-------PYWP----QALDQPT 1647
            ....::|:.|.|.|||...||.|:|.:|::.||.|   |.:.:       .|||    :.|.:.|
Human    78 EAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVML---NRIVEKESVKCAQYWPTDDQEMLFKET 139

  Fly  1648 HY------DD----YTVTCLKVQQLSHCSEYQLKLSMHGADAVLDLSLLQLKQWTKGAPAQLL-- 1700
            .:      :|    |||..|:::.:::.....:.|       .|.|.:|.:|:..|....:.:  
Human   140 GFSVKLLSEDVKSYYTVHLLQLENINYIENLWITL-------YLKLLMLDVKRSLKSGETRTISH 197

  Fly  1701 ---------GVAE------NALETHRQRCKAANAPQSPLIMNCLTGSERSELVA-IGVCAIIATQ 1749
                     ||.|      |.|...|: ..:.|....|.:::|..|..||...: :..|.::..:
Human   198 FHYTTWPDFGVPESPASFLNFLFKVRE-SGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEK 261

  Fly  1750 ----NKQPILLN 1757
                |.:.:|||
Human   262 GDDINIKQVLLN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mopNP_648722.2 BRO1_HD-PTP_like 2..363 CDD:185762
V_HD-PTP_like 368..702 CDD:185747
ALIX_LYPXL_bnd 421..699 CDD:290660
Med15 808..>1246 CDD:255446
Y_phosphatase 1558..1788 CDD:278528 66/246 (27%)
PTPc 1559..1745 CDD:238006 61/227 (27%)
PTPN2XP_005258181.1 PTP_DSP_cys 19..295 CDD:391942 72/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.