DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mop and B0280.17

DIOPT Version :9

Sequence 1:NP_648722.2 Gene:mop / 39610 FlyBaseID:FBgn0036448 Length:1833 Species:Drosophila melanogaster
Sequence 2:NP_001040836.2 Gene:B0280.17 / 4363051 WormBaseID:WBGene00044674 Length:260 Species:Caenorhabditis elegans


Alignment Length:154 Identity:36/154 - (23%)
Similarity:61/154 - (39%) Gaps:48/154 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1452 DLSSLENFDWDS---VSVTHSVSEKQTKASAT-------ANGHSSSFAFQSETFTDEKTTK-YFQ 1505
            |||||.|...|.   ::....:..:||.:..|       .||.|.:...:...|  ||..| :|.
 Worm    84 DLSSLRNLLKDDPLLMTPPPGLQRRQTFSPMTLSLIGGLKNGCSENENKEEGKF--EKIDKVFFP 146

  Fly  1506 KEVE---------------SYEKLLENLHVKM-LNGK--TQLGAK---------WQELQQKL--- 1540
            .|..               :..:|.::|..|: :.||  |:..||         |:.|::.:   
 Worm   147 PETANNTNPVGRLIGPRGMTIRQLEKDLGCKLFIRGKGCTKDDAKEERLRERVGWEHLKEPIHVM 211

  Fly  1541 -----DKEAAANKRSTTIAKLFPE 1559
                 |.|.||:::.::|.|:..|
 Worm   212 ISVRSDSEEAASEKLSSIKKMLQE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mopNP_648722.2 BRO1_HD-PTP_like 2..363 CDD:185762
V_HD-PTP_like 368..702 CDD:185747
ALIX_LYPXL_bnd 421..699 CDD:290660
Med15 808..>1246 CDD:255446
Y_phosphatase 1558..1788 CDD:278528 1/2 (50%)
PTPc 1559..1745 CDD:238006 1/1 (100%)
B0280.17NP_001040836.2 KH-I 141..260 CDD:381803 20/95 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.