DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mop and Ptp61F

DIOPT Version :9

Sequence 1:NP_648722.2 Gene:mop / 39610 FlyBaseID:FBgn0036448 Length:1833 Species:Drosophila melanogaster
Sequence 2:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster


Alignment Length:391 Identity:88/391 - (22%)
Similarity:150/391 - (38%) Gaps:115/391 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1470 VSEKQTKASATANGHSSSFAFQSETFTDEKTTKYFQKEVESYEKLLENLHVKMLNGKTQLGAKW- 1533
            :||::|..|.:|                  .....|.|.|..:|                |.:| 
  Fly     1 MSEQKTSGSGSA------------------AAARLQIEAEYKDK----------------GPQWH 31

  Fly  1534 ---QELQQKLDKEAAANKRSTTIAKLFPEK--NRSLDCLPYDHARVKLDKQTDDYINAAYMKNLS 1593
               :|:.:..|:||...:.||:.::....:  ||..|..||||:|:.|.:.:.|||||..:: |.
  Fly    32 RFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKRGSVDYINANLVQ-LE 95

  Fly  1594 AGCPNFIVAQTPQPNTINDFWSMIWSEKSRTVVCLHTPNELFDP-------YWP------QALDQ 1645
            .....:|:.|.|..:|:..||.|:|.:|||.|:.|   |:|.:.       |||      :||..
  Fly    96 RAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLML---NKLMEKKQIKCHLYWPNEMGADKALKL 157

  Fly  1646 PTHYDDYTVTCLKVQQLSHCSEYQLKLSMHGADAVLDLSLLQLKQ--------WTK-GAPAQLLG 1701
            |  :...||..::::...:......||:        ||...|.::        |.. |.|:    
  Fly   158 P--HVKLTVELVRLETYQNFVRRWFKLT--------DLETQQSREVMQFHYTTWPDFGIPS---- 208

  Fly  1702 VAENALETHRQRCK---AANAPQSPLIMNCLTGSERSELVAIGVCAIIATQNKQPILLNTIDVWS 1763
             :.||.....|:.:   ..:....|.:::|..|..||....:..|.::           .||.:.
  Fly   209 -SPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLV-----------LIDKYG 261

  Fly  1764 RICAQRQNSLRDSAILEQSMQIVLCNAHNVLNKRG-IMTSYQMKMAPQVTAKEQQENKDPLNELD 1827
                            |.::..|||...:.  :.| |.|:.|:..:.|...:..::..|| ..||
  Fly   262 ----------------ECNVSKVLCELRSY--RMGLIQTADQLDFSYQAIIEGIKKLHDP-TFLD 307

  Fly  1828 A 1828
            |
  Fly   308 A 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mopNP_648722.2 BRO1_HD-PTP_like 2..363 CDD:185762
V_HD-PTP_like 368..702 CDD:185747
ALIX_LYPXL_bnd 421..699 CDD:290660
Med15 808..>1246 CDD:255446
Y_phosphatase 1558..1788 CDD:278528 59/256 (23%)
PTPc 1559..1745 CDD:238006 55/212 (26%)
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 72/308 (23%)
PTPc 62..295 CDD:238006 66/280 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.