powered by:
Protein Alignment mop and F20B6.6
DIOPT Version :9
Sequence 1: | NP_648722.2 |
Gene: | mop / 39610 |
FlyBaseID: | FBgn0036448 |
Length: | 1833 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001359997.1 |
Gene: | F20B6.6 / 184714 |
WormBaseID: | WBGene00017630 |
Length: | 95 |
Species: | Caenorhabditis elegans |
Alignment Length: | 51 |
Identity: | 14/51 - (27%) |
Similarity: | 28/51 - (54%) |
Gaps: | 2/51 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 699 RDVQSEERQQRMQSVKA-ATTPVVSKPIAETTPVPAVSSTPKLRDYLKAKA 748
:|::.:|::||.:.:|. |:..::|.|...|....||.:..:.: ||...|
Worm 42 KDLEPKEKEQRAEMIKKWASAVMMSTPQQLTKEYKAVGNIVRYK-YLSPMA 91
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0789 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.