DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mop and C15H7.3

DIOPT Version :9

Sequence 1:NP_648722.2 Gene:mop / 39610 FlyBaseID:FBgn0036448 Length:1833 Species:Drosophila melanogaster
Sequence 2:NP_499135.1 Gene:C15H7.3 / 182639 WormBaseID:WBGene00007610 Length:398 Species:Caenorhabditis elegans


Alignment Length:343 Identity:75/343 - (21%)
Similarity:127/343 - (37%) Gaps:68/343 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1472 EKQTKASAT-------ANGHSS------SFAFQSETFT---DEKTTKYFQKEVESYEKLLENLHV 1520
            ||..|:..|       .||.:|      |.:.|||..|   |:|..|...|:.|..|:..|    
 Worm    37 EKSQKSRRTRKSRGPKGNGFTSRETIQPSSSGQSEGTTRMDDQKDEKKDDKKEEKKEERKE---- 97

  Fly  1521 KMLNGKTQLGAKWQELQQKLDKEAAANK--RSTTIAKLFPE-------------------KNRSL 1564
               ..|.::...|.|  ::..|...||.  .:|.:...|.:                   |.|:.
 Worm    98 ---EKKEEVKEPWSE--EEPAKRMVANGFFTTTNVGGTFKQTDNFKTPMDSCPSFKNNMHKIRAP 157

  Fly  1565 DCLPYDHARVKLDKQTDDYINAAYMKNLSAGCPNF----IVAQTPQPNT---INDFWSMIWSEKS 1622
            ||...:...|||....:.:|.||.:.     .|:|    |:.|.|..::   |.|||.||..|..
 Worm   158 DCPIPEEKLVKLTNGPESFICAAKIT-----VPDFNRTMILTQVPDLSSAPDIADFWRMIHQESI 217

  Fly  1623 RTVVCLHTPNEL-FDPYWPQALDQPTHYDDYTVTCLKVQQLSHCSEYQLKLSMHGADAVLDLSLL 1686
            .:||....|.|: .....|......:.|....|...||:.....:||.|::...|....|..::.
 Worm   218 ASVVIAVMPLEVTLQQILPLLSGTYSTYGKMFVNNKKVESAVGMTEYCLEIFPDGCSNSLLTTVY 282

  Fly  1687 QLKQWTKGAPAQLLGVAENALETHRQRCKAANAPQSPLIMNCLTGSERSELVAIGVCAIIATQNK 1751
            .|..|.:....:::......:|      |......:.::|: :.|:.|:..:.....|::..|..
 Worm   283 HLHNWRQKRGLEVVTDLVATME------KVMKVNDNTVLMS-MNGTGRAGTMLTLFTAMLQVQKG 340

  Fly  1752 QPILLNTIDVWSRICAQR 1769
            :.:  |..:..:.:.|:|
 Worm   341 KEV--NAKETLASLRAER 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mopNP_648722.2 BRO1_HD-PTP_like 2..363 CDD:185762
V_HD-PTP_like 368..702 CDD:185747
ALIX_LYPXL_bnd 421..699 CDD:290660
Med15 808..>1246 CDD:255446
Y_phosphatase 1558..1788 CDD:278528 48/239 (20%)
PTPc 1559..1745 CDD:238006 43/212 (20%)
C15H7.3NP_499135.1 PTPc 131..374 CDD:214550 49/240 (20%)
PTPc 148..374 CDD:304379 48/223 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.