DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mop and F47B3.7

DIOPT Version :10

Sequence 1:NP_648722.2 Gene:mop / 39610 FlyBaseID:FBgn0036448 Length:1833 Species:Drosophila melanogaster
Sequence 2:NP_491276.1 Gene:F47B3.7 / 171983 WormBaseID:WBGene00018531 Length:374 Species:Caenorhabditis elegans


Alignment Length:117 Identity:26/117 - (22%)
Similarity:44/117 - (37%) Gaps:15/117 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VGSCHVRSNSESLSAITPYRMSLDYNHRVLKRSYTDVFSRNSHIRTRQKEKKTRRRRTSSKGAI- 149
            :.:.| .:.|.:...|:|::.......|:    .|.:.|.|..:   .|......|...|||.| 
 Worm   114 ISTAH-HNQSVAHKNISPFKQRPKNETRI----ETQLVSHNVAL---SKFNARDLRAEKSKGTIE 170

  Fly   150 WKVNLIINTEELLQILSEDGRTNELIESVRAVAKGETSSITSSSSENFLSVV 201
            .:|.:.........|.....||      ::||......::||||.:.|..|:
 Worm   171 MEVYITARVSYKTWIFRSRRRT------LKAVCTPVMINVTSSSLDGFQRVL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mopNP_648722.2 BRO1_HD-PTP_like 2..363 CDD:185762 26/117 (22%)
V_HD-PTP_like 368..702 CDD:185747
Glutenin_hmw <795..1261 CDD:367362
PHA03247 <1329..1443 CDD:223021
PRK12323 <1378..1540 CDD:481241
Y_phosphatase 1558..1788 CDD:459674
F47B3.7NP_491276.1 PTPc 67..324 CDD:214550 26/117 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.