DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9384 and Mgat4d

DIOPT Version :9

Sequence 1:NP_001261847.1 Gene:CG9384 / 39608 FlyBaseID:FBgn0036446 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_017168435.1 Gene:Mgat4d / 67555 MGIID:1914805 Length:462 Species:Mus musculus


Alignment Length:320 Identity:121/320 - (37%)
Similarity:183/320 - (57%) Gaps:27/320 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 QLLRNASHISKGGSAN-----GSMARSQNIRLPNAY----HFLPHLLDDAGSLRPAYLQSKGRSD 160
            |:.|.|:|.:: .|.|     ||:. ||:..|||.:    :|||| |..||.|.||...||||:.
Mouse   158 QMKRKAAHTTR-SSGNFLEKKGSIL-SQHETLPNQFEVLKYFLPH-LRTAGKLYPAIATSKGRAG 219

  Fly   161 VSIVLGVPTVRREKQSYLLGTLHNLIENMNDEEQNETLIIVYIGETDMESVQLIARQIESSFDQH 225
            ||..||:.|:.|...:||..||.:::..|..||:.::::||.:.:||...::.:.|.:::.|.:.
Mouse   220 VSFALGISTINRGNHTYLKQTLTSVLSRMTPEEEEDSVVIVSVADTDESYLKSVVRMVKTKFRKQ 284

  Fly   226 VESGLIDIIAPAPSYYPNFERLRITLNDPLERV---KWRSKQNLDFAYLMAYAHSKGTFYVQLED 287
            |:||::::|:....:||.      ||.|...:.   .|:.||.|||..||.||..|.|:|:||||
Mouse   285 VQSGVLEVISIPTLFYPQ------TLLDKKTKTDSESWQIKQVLDFCILMLYAQPKATYYLQLED 343

  Fly   288 DILTKRQFITTMKKFALIKSALTKPDQPEWFVLDFCQLGFIGKMFKSAELPYLITYFQMFYNDKP 352
            ||:.|:.:.|.||.|  :.|..:|    .||.::|..||||||:|:|.:|...:.:|.|||..||
Mouse   344 DIVAKKMYFTKMKDF--VNSLTSK----NWFFIEFSVLGFIGKLFRSKDLTDFVHFFLMFYETKP 402

  Fly   353 VDWLLTYFIESKVCRTDKDQKHCNAEKAKYWQHFRKSLFQHIGTSSSLKGKVQKLKDKQF 412
            :|.||......:||.:.:..:.|...|..:...:|.|||||:||.||..|:.|.|||..:
Mouse   403 IDILLDDIFLIRVCISGEPVRSCLQRKKGFRIQYRPSLFQHVGTQSSFPGREQHLKDNYY 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9384NP_001261847.1 Glyco_transf_54 129..412 CDD:282514 111/289 (38%)
Mgat4dXP_017168435.1 Glyco_transf_54 185..462 CDD:368045 111/289 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838227
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28HC5
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D268757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12062
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.