DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9384 and LOC289035

DIOPT Version :9

Sequence 1:NP_001261847.1 Gene:CG9384 / 39608 FlyBaseID:FBgn0036446 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001013894.2 Gene:LOC289035 / 289035 RGDID:1359351 Length:468 Species:Rattus norvegicus


Alignment Length:466 Identity:99/466 - (21%)
Similarity:188/466 - (40%) Gaps:99/466 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 HLLDDA-------GSLRPAYLQSKGRSDVSIVLGVPTVRREKQSYLLGTLHNLIENMNDEEQNET 197
            |:|..|       .||:|..|         :.:|:.:::|..::|||.|:.:|.:..::::....
  Rat    74 HVLQHATYTVLAGSSLQPKRL---------LTVGIVSMQRSPRTYLLDTMTSLFQASSEQDLEYM 129

  Fly   198 LIIVYIGETDMESVQLIARQIESSFDQHVESGLIDII---------------APAPSYYPNFERL 247
            ||:|.:.:||.:.:......|...|..|:|||.:.::               :|....|      
  Rat   130 LILVLLSDTDPKWLNQTVANISGLFMPHIESGRLLVVHGLLGGSRAESRNHTSPCGKLY------ 188

  Fly   248 RITLNDPLERVKWRSKQNLDFAYLMAYAHSKGTFYVQLEDDILTKRQFITTMKKFALIKSALTKP 312
                          |:|.:....||..|.:...:::.|.|.:.:..:|::.      |..||:..
  Rat   189 --------------SRQKMSSVLLMNLARNLSEYFLMLGDKVHSAPRFLSD------IFWALSAW 233

  Fly   313 DQPEWFVLDFCQLGFIGKMFKSAELPYLITYFQMFYNDKPVDWLLTYFIESKVCRTDKDQKHCNA 377
            :|..|.:|||..:...||:|.:.:|..||::..:|..|.|...||:                   
  Rat   234 NQLPWVILDFSSMTISGKVFHTEDLSCLISFLLLFPKDIPTHLLLS------------------- 279

  Fly   378 EKAKYWQHFRKSLFQH--IGTSSSLKGKV---QKLKDKQFGSKVPQYYAHTHNPPALVKSNIAPY 437
                   .||..|.|:  |..|.|:..::   .:.:|..|.::.........||.|.|.:::..:
  Rat   280 -------EFRLLLSQNVPIRLSPSIFYRMDSNSEFEDTCFPAEQNDDLGRPDNPAATVFTDMISF 337

  Fly   438 KNYLLQRAY-RGESYFWGLLPQPGDLVQIIFERPTQLRHYLFRSGNSEHPSDRFYNTTVELLPAD 501
            .:...|.|| ..:.|||.|.|..|:.:.::.::|.::......:||:.:..:...:.  :||...
  Rat   338 WHTSPQYAYILNDDYFWALDPIKGNYLLVVLDKPQKVIQIAVETGNNVNKLNLLKHG--QLLLGY 400

  Fly   502 TLSENSSVWSSYNTTTDGYLVVGSFDSMGVAEGLLDAKIGAIKELRLHVHSDSENWALLSEIELQ 566
            :..:.....:.|  |..|.||.|..|.|...|.....:|..||.|....|...     :..::::
  Rat   401 SPMDYPKRCAQY--TLVGPLVRGQLDQMVFYEEDSVKEISCIKLLVTESHDYP-----IKIMQIK 458

  Fly   567 EWGSDSKSEDN 577
            .| ::.|.|:|
  Rat   459 VW-TEVKEEEN 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9384NP_001261847.1 Glyco_transf_54 129..412 CDD:282514 62/298 (21%)
LOC289035NP_001013894.2 Glyco_transf_54 55..319 CDD:282514 63/305 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342016
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D593094at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.