DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and TRX2

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_011725.3 Gene:TRX2 / 853123 SGDID:S000003441 Length:104 Species:Saccharomyces cerevisiae


Alignment Length:89 Identity:39/89 - (43%)
Similarity:53/89 - (59%) Gaps:3/89 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQY 77
            |.|.:|..:  |..:|.|:|:|||||||||.||.|.:|:.|..| ......|:||||..|:|.:.
Yeast     7 SASEYDSAL--ASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQY-SDAAFYKLDVDEVSDVAQKA 68

  Fly    78 EVNSMPTFLIIKNRVTLIQFVGGN 101
            ||:||||.:..|....:.:.||.|
Yeast    69 EVSSMPTLIFYKGGKEVTRVVGAN 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 39/89 (44%)
TRX2NP_011725.3 thioredoxin 6..104 CDD:200072 39/89 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1788
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
TreeFam 1 0.960 - -
87.670

Return to query results.
Submit another query.