DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and PLP1

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_010469.3 Gene:PLP1 / 851764 SGDID:S000002591 Length:230 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:25/108 - (23%)
Similarity:48/108 - (44%) Gaps:15/108 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQYEVNSMPTFLIIKNRVTL 94
            |::.|.....|.|..:..:||.||..|.....: |::|.....|..:..:..:|..:..||.:..
Yeast   103 VVIHFELETFGKCQYMNEKLENLAKRYLTTRFI-KVNVQTCPFLVNKLNIKVLPFVVGYKNGLEK 166

  Fly    95 IQFVG----GN------VERVVSTVEKFVGKVEDS---KEHKS 124
            :::||    ||      :.|:..:: ...|.:||:   ::|.|
Yeast   167 VRYVGFSKLGNDPNGFDIRRLEQSL-AHSGVIEDTFEIRKHSS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 20/90 (22%)
PLP1NP_010469.3 Phd_like_TxnDC9 80..192 CDD:239287 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.