DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and TH7

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_176182.1 Gene:TH7 / 842266 AraportID:AT1G59730 Length:129 Species:Arabidopsis thaliana


Alignment Length:105 Identity:32/105 - (30%)
Similarity:60/105 - (57%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIIVDSKSYFDKLIDD-AGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENE 71
            |:.::|:..:..|.|. .|:||.::::|.|.|||||..:.||:.::||.| ...:..::|||...
plant    23 VVEIESRRQWKSLFDSMKGSNKLLVIDFTAVWCGPCKAMEPRVREIASKY-SEAVFARVDVDRLM 86

  Fly    72 DLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEK 111
            |:|..|...::|.|:.:|....:.:.||...:.:|..:|:
plant    87 DVAGTYRAITLPAFVFVKRGEEIDRVVGAKPDELVKKIEQ 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 31/103 (30%)
TH7NP_176182.1 TRX_family 36..125 CDD:239245 28/89 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.680

Return to query results.
Submit another query.