DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and TXNDC2

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001091999.1 Gene:TXNDC2 / 84203 HGNCID:16470 Length:553 Species:Homo sapiens


Alignment Length:103 Identity:30/103 - (29%)
Similarity:54/103 - (52%) Gaps:2/103 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENE 71
            ||.::.||..|:..:.:|| .:.|.|:|.|||||||..|.|....|:..: ..::.|::|.|..|
Human   449 KVKVILSKEDFEASLKEAG-ERLVAVDFSATWCGPCRTIRPFFHALSVKH-EDVVFLEVDADNCE 511

  Fly    72 DLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTV 109
            ::..:..:..:|||...|....:.:..|...|::.:.:
Human   512 EVVRECAIMCVPTFQFYKKEEKVDELCGALKEKLEAVI 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 29/102 (28%)
TXNDC2NP_001091999.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..442
22 X 15 AA approximate tandem repeat of Q-P-K-X-G-D-I-P-K-S-[PS]-E-[KE]-X-I 113..442
TRX_family 457..550 CDD:239245 26/95 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.