DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and TRX5

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_175128.1 Gene:TRX5 / 841082 AraportID:AT1G45145 Length:118 Species:Arabidopsis thaliana


Alignment Length:128 Identity:38/128 - (29%)
Similarity:68/128 - (53%) Gaps:18/128 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AMQKKVIIVDSKSYFDKLIDDAG-TNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKID 66
            |.:.:||...:...:::.:.||. :.|.::::|.|:||.||..|.|...::|.. |..::..|||
plant     2 AGEGEVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKK-FTNVVFFKID 65

  Fly    67 VDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVGKVEDS-KEHKSKEGG 128
            |||.:.:|.:::|.:||||:.:|.         ||:      :::.||..:|. .|...|.||
plant    66 VDELQAVAQEFKVEAMPTFVFMKE---------GNI------IDRVVGAAKDEINEKLMKHGG 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 30/103 (29%)
TRX5NP_175128.1 TRX_family 16..108 CDD:239245 32/107 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2685
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.680

Return to query results.
Submit another query.