DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and TO2

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_564371.1 Gene:TO2 / 839988 AraportID:AT1G31020 Length:159 Species:Arabidopsis thaliana


Alignment Length:106 Identity:30/106 - (28%)
Similarity:56/106 - (52%) Gaps:4/106 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IIVDSKSYFDKLIDDAGTNKYVLVEFF-ATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDEN-- 70
            :::.|::.|:..:..|.......|.:| |.|||||.:|.|.:.:|::.| ..:...|:|:||.  
plant    52 VVLKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKY-PDVTTYKVDIDEGGL 115

  Fly    71 EDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEK 111
            .:...:..|:::||....|..|...:.||.:|.|:.|.:|:
plant   116 SNAIGKLNVSAVPTLQFFKGGVKKAEIVGVDVVRLKSVMEQ 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 29/104 (28%)
TO2NP_564371.1 TRX_family 58..146 CDD:239245 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.