DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and CXXS1

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_172620.1 Gene:CXXS1 / 837696 AraportID:AT1G11530 Length:118 Species:Arabidopsis thaliana


Alignment Length:108 Identity:34/108 - (31%)
Similarity:60/108 - (55%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVDSKSYFDKLIDDA-GTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDEN 70
            :|:.:||...::..:..| ..|..::..|.|.||.|...:....|:||.:|...:.:: :||||.
plant     3 RVVKIDSAESWNFYVSQAKNQNCPIVAHFTALWCIPSVFMNSFFEELAFNYKDALFLI-VDVDEV 66

  Fly    71 EDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFV 113
            :::|.|.||.:|||||.:|:...:.:.||.|.:.:...|:.||
plant    67 KEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEIKKRVDGFV 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 32/103 (31%)
CXXS1NP_172620.1 TRX_family 11..106 CDD:239245 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.