DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and WCRKC2

DIOPT Version :10

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_196046.2 Gene:WCRKC2 / 830305 AraportID:AT5G04260 Length:192 Species:Arabidopsis thaliana


Alignment Length:118 Identity:32/118 - (27%)
Similarity:61/118 - (51%) Gaps:18/118 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KSYFDKLIDDA-GTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQY 77
            :|:||::::|| ...:.|::.:.|.||..|..:.|:||:||::::.|:....:||:     ||.|
plant    84 ESHFDQVMEDAQKLGESVVIVWMAAWCRKCIYLKPKLEKLAAEFYPRLRFYHVDVN-----AVPY 143

  Fly    78 E------VNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVGKVEDSKEHKS 124
            .      |..|||..:.::.....:.:||:....|      |.:|.:..|:.|
plant   144 RLVSRAGVTKMPTIQLWRDGQKQAEVIGGHKAHFV------VNEVREMIENDS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 CnoX 7..99 CDD:442352 25/91 (27%)
WCRKC2NP_196046.2 TRX_family 85..187 CDD:239245 30/112 (27%)

Return to query results.
Submit another query.