DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and ACHT2

DIOPT Version :10

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_849469.1 Gene:ACHT2 / 829088 AraportID:AT4G29670 Length:236 Species:Arabidopsis thaliana


Alignment Length:78 Identity:23/78 - (29%)
Similarity:42/78 - (53%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENED 72
            ::.:.|...|...:..|| .:.|:|||:.|||..|..:.|:|.:.|.:: ..::.||::.|||:.
plant   105 MVDIHSTEEFLSALSGAG-ERLVIVEFYGTWCASCRALFPKLCKTAVEH-PDIVFLKVNFDENKP 167

  Fly    73 LAVQYEVNSMPTF 85
            :.....|..:|.|
plant   168 MCKSLNVRVLPFF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 CnoX 7..99 CDD:442352 23/78 (29%)
ACHT2NP_849469.1 TRX_family 112..213 CDD:239245 22/71 (31%)

Return to query results.
Submit another query.