DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and AT4G12170

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_192954.2 Gene:AT4G12170 / 826825 AraportID:AT4G12170 Length:153 Species:Arabidopsis thaliana


Alignment Length:120 Identity:29/120 - (24%)
Similarity:48/120 - (40%) Gaps:18/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVDSKSYFDKLIDDAGTNKY----------VLVEFFATWCGPCAMIGPRLEQLASDYFGRML 61
            |..:..|....|.|:.....:::          |:|.|.|..|..|..:.|.||.|.|:|...:.
plant    37 KAYVSSSLPSHDGLVQSLSASEWNSLVIQSKVPVIVVFIAKDCAECGSLMPELEFLDSEYEYMLK 101

  Fly    62 VLKIDVDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVGKV 116
            ...:|.||..:||..|.:...|..::.|.        |...|||:....:.:|::
plant   102 FYTVDTDEELELAKDYRIEYHPITIVFKG--------GEEKERVLGYYPQMLGQL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 27/112 (24%)
AT4G12170NP_192954.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45663
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.980

Return to query results.
Submit another query.