DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and ATHM2

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_192261.1 Gene:ATHM2 / 825653 AraportID:AT4G03520 Length:186 Species:Arabidopsis thaliana


Alignment Length:115 Identity:39/115 - (33%)
Similarity:60/115 - (52%) Gaps:21/115 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDL 73
            |.|.:.|.:|.|:..|  ...|:|:|:|.|||||.||.|.:..||..|.|::...|::.||:.:.
plant    82 IQVVNDSTWDSLVLKA--TGPVVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNT 144

  Fly    74 AVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVV----------STVEKFV 113
            ..||.|.|:||.:|         ||||..:..:          |:::||:
plant   145 PGQYGVRSIPTIMI---------FVGGEKKDTIIGAVPKTTLTSSLDKFL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 37/111 (33%)
ATHM2NP_192261.1 thioredoxin 85..185 CDD:200072 36/110 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR45663
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.