DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and AT3G56420

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001325846.1 Gene:AT3G56420 / 824809 AraportID:AT3G56420 Length:154 Species:Arabidopsis thaliana


Alignment Length:102 Identity:27/102 - (26%)
Similarity:51/102 - (50%) Gaps:5/102 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQYEVNSM 82
            :|:.:.....|.::|.|.|.||.||..|.|....|||.| ..|:.:.:||:|..:.:.::.|.:.
plant    53 EKITEANNHGKILVVNFSAPWCVPCKKIEPVFRDLASRY-PSMIFVTVDVEELAEFSNEWNVEAT 116

  Fly    83 PTFLIIKNRVTLIQFVGGNV----ERVVSTVEKFVGK 115
            ||.:.:|:...:.:.||...    ::..:..:.|:.|
plant   117 PTVVFLKDGRQMDKLVGAETSELQKKTAAAADLFLRK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 25/96 (26%)
AT3G56420NP_001325846.1 TRX_family 49..142 CDD:239245 25/89 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.