DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and TRX1

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_190672.1 Gene:TRX1 / 824267 AraportID:AT3G51030 Length:114 Species:Arabidopsis thaliana


Alignment Length:112 Identity:37/112 - (33%)
Similarity:62/112 - (55%) Gaps:2/112 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAMQKKVIIVDSKSYFDKLIDDAGTNK-YVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLK 64
            ||:.:.:||...:...:::.:..|..:| .|:|:|.|:|||||..|.|....||.. ...:|.||
plant     1 MASEEGQVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKK-LPNVLFLK 64

  Fly    65 IDVDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEK 111
            :|.||.:.:|..:.:.:||||:.:|....|.:.||...:.:.||:.|
plant    65 VDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 34/103 (33%)
TRX1NP_190672.1 TRX_family 19..110 CDD:239245 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2685
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.680

Return to query results.
Submit another query.