DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and TRXF1

DIOPT Version :10

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_186922.1 Gene:TRXF1 / 821260 AraportID:AT3G02730 Length:178 Species:Arabidopsis thaliana


Alignment Length:105 Identity:32/105 - (30%)
Similarity:60/105 - (57%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVD-EN 70
            :|..|| |..|..::..|| .|.|:::.:..|||||.:|.|:.:.| |:.:..::.||:|.: :|
plant    69 QVTEVD-KDTFWPIVKAAG-EKLVVLDMYTQWCGPCKVIAPKYKAL-SEKYDDVVFLKLDCNPDN 130

  Fly    71 EDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVE 110
            ..||.:..:..:|||.|:|:...:.:..|...:.:|:.:|
plant   131 RPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 CnoX 7..99 CDD:442352 29/92 (32%)
TRXF1NP_186922.1 TRX_family 76..170 CDD:239245 27/95 (28%)

Return to query results.
Submit another query.