DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and TRX-M4

DIOPT Version :10

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_188155.1 Gene:TRX-M4 / 820775 AraportID:AT3G15360 Length:193 Species:Arabidopsis thaliana


Alignment Length:85 Identity:35/85 - (41%)
Similarity:52/85 - (61%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQYEVNSMPTFLIIKNRVTL 94
            |||||:|.|||||.||.|.::|||.|:.|:....||:.||:.:.|.:|.:.|:||.:|.|.....
plant   107 VLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNTANRYGIRSVPTVIIFKGGEKK 171

  Fly    95 IQFVGG-NVERVVSTVEKFV 113
            ...:|. ..|.:..|:|:|:
plant   172 DSIIGAVPRETLEKTIERFL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 CnoX 7..99 CDD:442352 30/68 (44%)
TRX-M4NP_188155.1 CnoX 90..191 CDD:442352 34/83 (41%)

Return to query results.
Submit another query.