DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and TH9

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001078124.1 Gene:TH9 / 820018 AraportID:AT3G08710 Length:140 Species:Arabidopsis thaliana


Alignment Length:113 Identity:35/113 - (30%)
Similarity:59/113 - (52%) Gaps:1/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDL 73
            :|...:|:.|||.:.....|.|:..|.|||||||.::.|...:|:..:...|.:| :||||..|.
plant    27 LITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIELSEKHSSLMFLL-VDVDELSDF 90

  Fly    74 AVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVGKVEDSKE 121
            :..:::.:.|||..:||...:.:.||.|...:...|...:..|.:|.:
plant    91 SSSWDIKATPTFFFLKNGQQIGKLVGANKPELQKKVTSIIDSVPESPQ 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 33/101 (33%)
TH9NP_001078124.1 TRX_family 32..126 CDD:239245 31/94 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.680

Return to query results.
Submit another query.