powered by:
Protein Alignment CG13473 and TRX z
DIOPT Version :9
Sequence 1: | NP_648717.1 |
Gene: | CG13473 / 39603 |
FlyBaseID: | FBgn0036442 |
Length: | 139 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_187329.1 |
Gene: | TRX z / 819858 |
AraportID: | AT3G06730 |
Length: | 183 |
Species: | Arabidopsis thaliana |
Alignment Length: | 59 |
Identity: | 22/59 - (37%) |
Similarity: | 37/59 - (62%) |
Gaps: | 0/59 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 VLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQYEVNSMPTFLII 88
::|:|:|||||||.::...||.||.:|....:::|:|.|:..:.|...:|..:||...|
plant 97 LIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLPTLFFI 155
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0907 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1482186at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.