DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and AT3G04780

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_566238.1 Gene:AT3G04780 / 819638 AraportID:AT3G04780 Length:176 Species:Arabidopsis thaliana


Alignment Length:62 Identity:18/62 - (29%)
Similarity:28/62 - (45%) Gaps:7/62 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GRMLVLKIDVDEN-EDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVGKVED 118
            |:.:|||....:| ..|.:..|.|...:.:   .:|..|...|..||   :|..|.:.|:||
plant   120 GKPVVLKYVKFQNVRSLTIFIEANQSGSEV---TKVQKIALYGSTVE---TTDMKGLKKIED 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 14/53 (26%)
AT3G04780NP_566238.1 PITH 18..160 CDD:399305 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.