powered by:
Protein Alignment CG13473 and AT3G04780
DIOPT Version :9
Sequence 1: | NP_648717.1 |
Gene: | CG13473 / 39603 |
FlyBaseID: | FBgn0036442 |
Length: | 139 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_566238.1 |
Gene: | AT3G04780 / 819638 |
AraportID: | AT3G04780 |
Length: | 176 |
Species: | Arabidopsis thaliana |
Alignment Length: | 62 |
Identity: | 18/62 - (29%) |
Similarity: | 28/62 - (45%) |
Gaps: | 7/62 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 GRMLVLKIDVDEN-EDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVGKVED 118
|:.:|||....:| ..|.:..|.|...:.: .:|..|...|..|| :|..|.:.|:||
plant 120 GKPVVLKYVKFQNVRSLTIFIEANQSGSEV---TKVQKIALYGSTVE---TTDMKGLKKIED 175
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1482186at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100096 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.