DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and ATHM3

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001154520.1 Gene:ATHM3 / 816050 AraportID:AT2G15570 Length:174 Species:Arabidopsis thaliana


Alignment Length:109 Identity:31/109 - (28%)
Similarity:60/109 - (55%) Gaps:13/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAV 75
            |..:|:.|.::.   :...|||||:.:|||||.|:...::::|.||.|::....::.|.:..:|.
plant    72 VTQRSWEDSVLK---SETPVLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAE 133

  Fly    76 QYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEK--FVGKVE 117
            :||:.::|..|:.||        |...|.::.|:.|  ::..:|
plant   134 EYEIKAVPVVLLFKN--------GEKRESIMGTMPKEFYISAIE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 29/99 (29%)
ATHM3NP_001154520.1 Thioredoxin_like 72..172 CDD:294274 31/109 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.