DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13473 and Nme8

DIOPT Version :9

Sequence 1:	NP_648717.1	Gene:	CG13473 / 39603	FlyBaseID:	FBgn0036442	Length:	139	Species:	Drosophila melanogaster
Sequence 2:	NP_853622.2	Gene:	Nme8 / 73412	MGIID:	1920662	Length:	586	Species:	Mus musculus

Alignment Length:	132	Identity:	25/132 - (18%)
Similarity:	56/132 - (42%)	Gaps:	37/132 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MAAMQKKV---IIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLV 62
            ||:.:::|   .:|:|::.:|:::.:.|   ..:::.:..|||||..:             :.|.
Mouse     1 MASKKREVQLQSVVNSQNLWDEMLLNKG---LTVIDVYQAWCGPCKAV-------------QSLF 49

  Fly    63 LKIDVDENEDLAVQYEV--------------NSMPTFLIIKNRVTLIQFVGGNV----ERVVSTV 109
            .|:..:.|||..:.:.|              ...|.||...|...:.:..|.|.    .:|::.:
Mouse    50 RKLKNELNEDEILHFVVAEADNIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVITLI 114

  Fly   110 EK 111
            ::
Mouse   115 DE 116

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13473	NP_648717.1	Thioredoxin	8..111	CDD:278513	23/123 (19%)
Nme8	NP_853622.2	TRX_NDPK	11..113	CDD:239246	22/117 (19%)
		NDPk	155..301	CDD:260363
		NDK 1	157..254
		NDK 2	312..452
		NDK	313..450	CDD:197791
		NDPk_TX	313..445	CDD:239879
		NDK	448..581	CDD:197791
		NDPk	448..579	CDD:260363
		NDK 3	453..586
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0907
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900