DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and TXN

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_003320.2 Gene:TXN / 7295 HGNCID:12435 Length:105 Species:Homo sapiens


Alignment Length:103 Identity:41/103 - (39%)
Similarity:66/103 - (64%) Gaps:2/103 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAV 75
            ::||:.|.:.:|.|| :|.|:|:|.|||||||.||.|....| |:.:..::.|::|||:.:|:|.
Human     5 IESKTAFQEALDAAG-DKLVVVDFSATWCGPCKMIKPFFHSL-SEKYSNVIFLEVDVDDCQDVAS 67

  Fly    76 QYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFV 113
            :.||..||||...|....:.:|.|.|.|::.:|:.:.|
Human    68 ECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 40/99 (40%)
TXNNP_003320.2 TRX_family 11..102 CDD:239245 38/92 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.680

Return to query results.
Submit another query.