DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and pdia2

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001011281.1 Gene:pdia2 / 496734 XenbaseID:XB-GENE-5770794 Length:526 Species:Xenopus tropicalis


Alignment Length:137 Identity:39/137 - (28%)
Similarity:71/137 - (51%) Gaps:18/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MQKKVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLA---SDYFGRMLVLKI 65
            :::..::|.:|..|||.::   |.||:||||:|.|||.|..:.|:..:.|   .|....:.:.|:
 Frog    43 LEEDNVLVLNKKNFDKALE---TYKYLLVEFYAPWCGHCQELAPKYAKAAEILKDKSEEVRLAKV 104

  Fly    66 DVDENEDLAVQYEVNSMPTFLIIK--NRVTLIQFVGGNVER--VVSTVEKFVG-------KVEDS 119
            |.....:|::::.||..||....|  ||...|.: ||..::  :|..:.:.:|       |||.:
 Frog   105 DATVESELSMEFNVNGYPTLKFFKGGNRTGHIDY-GGKRDQDGLVKWMLRRLGPAAIVLDKVESA 168

  Fly   120 KEHKSKE 126
            ::..|.:
 Frog   169 EKFTSSQ 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 34/109 (31%)
pdia2NP_001011281.1 YbbN 46..502 CDD:331940 39/134 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.