DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and txnl1

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001006844.1 Gene:txnl1 / 448593 XenbaseID:XB-GENE-965625 Length:289 Species:Xenopus tropicalis


Alignment Length:131 Identity:34/131 - (25%)
Similarity:62/131 - (47%) Gaps:15/131 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENE 71
            |||..|.:  |...:..|| ::..:|:|....|.||..|.|....|::.| .:.:.|::||.:.:
 Frog     5 KVIGADGE--FQGDLTAAG-SRLSVVKFTMKGCAPCVRIAPAFTSLSNKY-PQAIFLEVDVHQCQ 65

  Fly    72 DLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVGKVEDSKEH-KSKEGGASSATVP 135
            ..|....:::.||||..:|:|.:.|:.|.:.          .|..:..|:| ::..|....|.:|
 Frog    66 ATATANNISATPTFLFFRNKVKIDQYQGADA----------AGLEDKIKQHLENDPGNNEDADIP 120

  Fly   136 K 136
            :
 Frog   121 R 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 27/102 (26%)
txnl1NP_001006844.1 TRX_family 12..104 CDD:239245 25/105 (24%)
PITH 126..268 CDD:368787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.