DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and txndc5

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:XP_005162560.1 Gene:txndc5 / 406289 ZFINID:ZDB-GENE-040426-1951 Length:403 Species:Danio rerio


Alignment Length:112 Identity:32/112 - (28%)
Similarity:55/112 - (49%) Gaps:8/112 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VEFFATWCGPCAMIGPRLEQLAS--DYFGRMLVLKIDVDENEDLAVQYEVNSMPTFLIIKNRVTL 94
            |:|||.|||.|..:.|..|||||  ::...:.:.|:|..::.::....:|...||.|...:...:
Zfish   179 VKFFAPWCGHCKAMAPTWEQLASSFEHSDSIKISKVDCTQHYEVCSDNQVRGYPTLLFFTDGEKI 243

  Fly    95 IQFVGGNVERVVSTVEKFVG---KVEDSKEHKSKEGGASSATVPKLE 138
            .|:.|   :|.:.:.::||.   |..:||:...||...:....|..|
Zfish   244 DQYKG---KRDLDSFKEFVDNHVKAAESKDEPEKEEEHTHEIPPSAE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 23/80 (29%)
txndc5XP_005162560.1 ER_PDI_fam 33..403 CDD:273457 32/112 (29%)
Thioredoxin_like 34..133 CDD:294274
PDI_a_ERp46 159..259 CDD:239303 23/82 (28%)
PDI_a_ERp46 294..395 CDD:239303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.